From nobody Mon May 18 18:21:23 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 78BE63A0FBA for ; Mon, 18 May 2020 18:21:21 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: 0.105 X-Spam-Level: X-Spam-Status: No, score=0.105 tagged_above=-999 required=5 tests=[HTML_MESSAGE=0.001, MIME_HTML_ONLY=0.1, RCVD_IN_MSPIKE_H3=0.001, RCVD_IN_MSPIKE_WL=0.001, SPF_NONE=0.001, URIBL_BLOCKED=0.001] autolearn=no autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id iDzYwkmSvuxW for ; Mon, 18 May 2020 18:21:20 -0700 (PDT) Received: from mout.perfora.net (mout.perfora.net [74.208.4.197]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 5A6283A0FAB for ; Mon, 18 May 2020 18:21:20 -0700 (PDT) Received: from oxusgaltgw02.schlund.de ([10.72.72.48]) by mrelay.perfora.net (mreueus002 [74.208.5.2]) with ESMTPSA (Nemesis) id 0LvUYv-1isCom2oLL-010gTS for ; Tue, 19 May 2020 03:21:19 +0200 Date: Mon, 18 May 2020 21:21:19 -0400 (EDT) From: Timothy Mcsweeney Reply-To: Timothy Mcsweeney To: uri-review@ietf.org Message-ID: <491516506.246380.1589851279474@email.ionos.com> MIME-Version: 1.0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: 7bit X-Priority: 3 Importance: Normal X-Originating-Client: open-xchange-appsuite X-Mailer: Open-Xchange Mailer v7.10.1-Rev30 X-Provags-ID: V03:K1:40vHEInFloHd8pWCcFNQwLl97knc/C8bjgH2DKsVR40AWo2eaA8 BYpv6ikqZAEFSny/ZHp/2eg3DhbbqbkUfd/ea0aHVuk+DSCy6Up30hW2CIc8Gpq8xatP9BW JNc9/qRCbN9mGg1/+yir6wQWM40D7vYm/itWhtu3KFCjjm/kada0ryAb/0Q6zJD1FgdYkR0 AoFfsOY4XYK7aL326Q/Yw== X-UI-Out-Filterresults: notjunk:1;V03:K0:sSMV/M8YMdg=:hw/pgrBGwAFJxR6iC7vPDP KB5PabRdmuAEPuFiQp3Yojy6SbYrGwvO2RhmXwFnLVu053BJ99QwfhjZ9R9TUGM1WqupoXgB6 09j4PlXIuzBjqoVq/AVSC7f2eViT40apK+FgyZ7UxmQzyILPJqFZCsxlvcA20gTNYtO+fDVGA j7u76hTQyDU6GAqxul7X9gmNOal15GeXSlXbJ3/BLQyMQpU0fG4dLM9TkINMck93G7T5pCL97 heTpcwED/rZyU8jArrna65I29ZSgIZBvL9aCkSrosG/0fTwrqUH8mrLosZHB8F6OpruEvT+jU 9r2LE80RL+Q93R2PCDaCU9dg+gBbR3EuOrcOlmSVKBGTUDEXXpvOMwb2DCDz+fXY2HigN9lm6 VGL0rA2BLKrMS9TTdFbxkbqPEYKCvczynxSyqVFV2YMhM3APw/4O1ZCknJoGmTUm2doM+Rffn uPjAiBk1RUKf0hPB7IRhOFC+m4fk8nR6xPOgIyGJPrrDBKUpPs/EE9FLeYFFAGvhbBchQzqTG tNczn1WnVC4n2qSAtEfVNMchL9bfdclnqSTFBoka06vu0rsXW7mzBzNP7YeOKtwf/PhWaHma7 P4HsulekzyzZU+t9bexZkUmzPnf5kxbYYmyfd2UxO+HnlMQJruJytgk3vBgZsxITN/p4zDTPr LfPTh1iNko2SznWXpYq8b9E9jeUeOiT4HB0XFLw378+ye6EpR5GVxoRwWiKtYSqkOGm4BLLXm snH7DaI1rsoMtpP060PZFSo/p8llZ/KiImFbsYbKcZDyXMmprblZQs3tHZy7Ubt3e72L68NaM yjCsxq9ZFrhTm8lC3NBtcosSO9NA6G6AJZxcc0/QIYIuq/440KMcKrIvu2XhOhT4XxSvcut Archived-At: Subject: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 19 May 2020 01:21:22 -0000
Hello everyone, 

This is a request for a review of the 'drop' URI scheme.  The draft can be found here < https://datatracker.ietf.org/doc/draft-mcsweeney-drop-scheme/>.  Thank you. 

Sincerely, 
Tim McSweeney
From nobody Tue May 19 02:40:36 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 839193A131F for ; Tue, 19 May 2020 02:40:35 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: 0.003 X-Spam-Level: X-Spam-Status: No, score=0.003 tagged_above=-999 required=5 tests=[RCVD_IN_MSPIKE_H4=0.001, RCVD_IN_MSPIKE_WL=0.001, SPF_HELO_NONE=0.001, SPF_PASS=-0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id sFV13n6Uo9io for ; Tue, 19 May 2020 02:40:33 -0700 (PDT) Received: from loire.is.ed.ac.uk (loire.is.ed.ac.uk [129.215.16.10]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id AD95C3A09D1 for ; Tue, 19 May 2020 02:40:32 -0700 (PDT) Received: from crunchie.inf.ed.ac.uk (crunchie.inf.ed.ac.uk [129.215.202.41]) by loire.is.ed.ac.uk (8.14.7/8.14.7) with ESMTP id 04J9eThN003256 (version=TLSv1/SSLv3 cipher=ECDHE-RSA-AES256-GCM-SHA384 bits=256 verify=NOT) for ; Tue, 19 May 2020 10:40:29 +0100 Received: from ecclerig.inf.ed.ac.uk (ecclerig.inf.ed.ac.uk [129.215.24.151]) by crunchie.inf.ed.ac.uk (8.14.7/8.14.7) with ESMTP id 04J9eSMp023345 for ; Tue, 19 May 2020 10:40:28 +0100 Received: from ecclerig.inf.ed.ac.uk (localhost [127.0.0.1]) by ecclerig.inf.ed.ac.uk (8.14.7/8.14.7) with ESMTP id 04J9eSCx029407 for ; Tue, 19 May 2020 10:40:29 +0100 Received: (from ht@localhost) by ecclerig.inf.ed.ac.uk (8.14.7/8.14.7/Submit) id 04J9ePgj029405; Tue, 19 May 2020 10:40:25 +0100 X-Authentication-Warning: ecclerig.inf.ed.ac.uk: ht set sender to ht@inf.ed.ac.uk using -f To: uri-review@ietf.org References: <491516506.246380.1589851279474@email.ionos.com> From: "Henry S. Thompson" Date: Tue, 19 May 2020 10:40:25 +0100 In-Reply-To: <491516506.246380.1589851279474@email.ionos.com> (Timothy Mcsweeney's message of "Mon\, 18 May 2020 21\:21\:19 -0400 \(EDT\)") Message-ID: User-Agent: Gnus/5.1012 (Gnus v5.10.12) XEmacs/21.5-b34 (linux) MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii X-Edinburgh-Scanned: at loire.is.ed.ac.uk with MIMEDefang 2.84, Sophie, Sophos Anti-Virus, Clam AntiVirus X-Scanned-By: MIMEDefang 2.84 on 129.215.16.10 Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 19 May 2020 09:40:36 -0000 Timothy Mcsweeney writes: > This is a request for a review of the 'drop' URI scheme.  The > draft can be found here > https://datatracker.ietf.org/doc/draft-mcsweeney-drop-scheme/ Without commenting on any other aspect of the proposed scheme, and mostly just to save people time, I found the following aspect of the proposal somewhat misleading: "Similar to the previously registered 'tel' [RFC3966] and 'leaptofrogans' [RFC8589] URIs, the 'drop' URI scheme is syntactically correct but does not need to use all 5 of the parse-able components available to it. The 'drop' scheme uses the number sign '#' as a general delimiter as seen in Appendix A. Collected ABNF [RFC3986]. The scheme syntax is as follows: " drop-uri = 'drop#' character string drop # fg34htx \__/ \_/ \_____/ | | | | " I read this as implying that 1) 'tel' and 'leaptofrogans' URIs did not begin "tel:" and "leaptofrogans:"; 2) The 3986 ABNF for URIs recognises "drop#fg34htx" as a URI. Neither of these is in fact that case. The two referenced schemes require ':' after the 'scheme' component, and the 'URI' production does _not_ recognise the above example. (The 'URI-reference' production does, but not using the 'scheme' production to cover the "drop" part.) ht -- Henry S. Thompson, School of Informatics, University of Edinburgh 10 Crichton Street, Edinburgh EH8 9AB, SCOTLAND -- (44) 131 650-4440 Fax: (44) 131 650-4587, e-mail: ht@inf.ed.ac.uk URL: http://www.ltg.ed.ac.uk/~ht/ [mail from me _always_ has a .sig like this -- mail without it is forged spam] The University of Edinburgh is a charitable body, registered in Scotland, with registration number SC005336. From nobody Tue May 19 04:33:39 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 257283A084B for ; Tue, 19 May 2020 04:33:37 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: 0 X-Spam-Level: X-Spam-Status: No, score=0 tagged_above=-999 required=5 tests=[DKIM_SIGNED=0.1, DKIM_VALID=-0.1, MSGID_FROM_MTA_HEADER=0.001, RCVD_IN_MSPIKE_H2=-0.001, SPF_PASS=-0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no Authentication-Results: ietfa.amsl.com (amavisd-new); dkim=pass (1024-bit key) header.d=itaoyama.onmicrosoft.com Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id hsWaP7B1SAcK for ; Tue, 19 May 2020 04:33:34 -0700 (PDT) Received: from JPN01-OS2-obe.outbound.protection.outlook.com (mail-eopbgr1410134.outbound.protection.outlook.com [40.107.141.134]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id EE30E3A0857 for ; Tue, 19 May 2020 04:33:33 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=V08wqExRqpedQW/82JohKFqfKVAsJnRbmq5LN+J4xWMIjPbR29hSeZkbDFg/f1C/iMFBzWEuIi2m9vD692/3D48KaUw0ESQJVizL6+Dekeen7YJZu57x1r1eQ0ngxhX25Er97QT3cOcTLJxvDTuTTCYkHeK6LGAXba60qAPHMzKOkAGez1rxonzMxD2zVotDMz2CIulpXhL3lIYBpJmNw+N9/7uKwMLFlYcH8EysvzZ4XCrGl8ASp9gM5WLSvL3ZMCt2sHSdw1VWlefZWGDoYE7lP1cMYE+U7fnY5KO1h4EBYOKply+VzmBLj5ruRnoI0JXbpeBicHGyeGftz/+tOw== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=35OT8u2rj9fbrBxz6zBeYJ93mDKauVZ6z1CQOjIn3ME=; b=GI8sEFGtFvuEwn6RzEU+k5JySk6TKUKFGXUw51KtS4n7AN/y0AO6SCOh6R80L75jrR7KQKedJxut0EJrYa1851vqTpV65wKo/TU2M+V3Y05FYce7Gua68J5TwqhkGLSYammKt0JvUJz+gHrHdBOZD0AZdiivyldhQHanpqnAZD9G2ANGwTl+uTUnxa+geqwIp/YTiB6FMd4mUfvPoItIspP9p1O+1P1/if69GspvOXJS+EmMDthZIJ4UHqCjYRavFanCY8F9gWabY2St2+K1oefqJ9r0eotfKuYnfQI//uORqgXCiGYqIpzKepZUpp3aAH+UOfxuKoU2DnNmBFmFgA== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=pass smtp.mailfrom=it.aoyama.ac.jp; dmarc=pass action=none header.from=it.aoyama.ac.jp; dkim=pass header.d=it.aoyama.ac.jp; arc=none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=itaoyama.onmicrosoft.com; s=selector2-itaoyama-onmicrosoft-com; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=35OT8u2rj9fbrBxz6zBeYJ93mDKauVZ6z1CQOjIn3ME=; b=mBtfGSNMXdulGnwIH5ZAsi1rOrN3Qtyk/9LxJMUEqoOhrXjEaWkfj2s45SLgmor6+++KaURRo6cTKwDZGTqCmp9rg3+XBbGEw9zE+7Pb0w0GQsYuSEemdqWX6UOc30wmHB+E4bHyNIQ3I4QknpQ/huVVw31fCr7qPnHH4m1mdHc= Authentication-Results: ietf.org; dkim=none (message not signed) header.d=none;ietf.org; dmarc=none action=none header.from=it.aoyama.ac.jp; Received: from OSBPR01MB2566.jpnprd01.prod.outlook.com (2603:1096:604:1c::13) by OSBPR01MB1877.jpnprd01.prod.outlook.com (2603:1096:603:5::22) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.3000.27; Tue, 19 May 2020 11:33:31 +0000 Received: from OSBPR01MB2566.jpnprd01.prod.outlook.com ([fe80::80a8:73bf:9ca8:7aae]) by OSBPR01MB2566.jpnprd01.prod.outlook.com ([fe80::80a8:73bf:9ca8:7aae%5]) with mapi id 15.20.3000.034; Tue, 19 May 2020 11:33:31 +0000 To: "Henry S. Thompson" , uri-review@ietf.org References: <491516506.246380.1589851279474@email.ionos.com> From: =?UTF-8?Q?Martin_J=2e_D=c3=bcrst?= Organization: Aoyama Gakuin University Message-ID: <4de2475c-a888-5110-fad4-c0091dc6a089@it.aoyama.ac.jp> Date: Tue, 19 May 2020 20:33:28 +0900 User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; rv:68.0) Gecko/20100101 Thunderbird/68.8.0 In-Reply-To: Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-ClientProxiedBy: TYAPR01CA0139.jpnprd01.prod.outlook.com (2603:1096:404:2d::31) To OSBPR01MB2566.jpnprd01.prod.outlook.com (2603:1096:604:1c::13) MIME-Version: 1.0 X-MS-Exchange-MessageSentRepresentingType: 1 Received: from [192.168.1.6] (125.203.82.4) by TYAPR01CA0139.jpnprd01.prod.outlook.com (2603:1096:404:2d::31) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.3000.27 via Frontend Transport; Tue, 19 May 2020 11:33:31 +0000 X-Originating-IP: [125.203.82.4] X-MS-PublicTrafficType: Email X-MS-Office365-Filtering-Correlation-Id: bc6f25a7-535c-4f27-1d52-08d7fbe8755c X-MS-TrafficTypeDiagnostic: OSBPR01MB1877: X-Microsoft-Antispam-PRVS: X-MS-Oob-TLC-OOBClassifiers: OLM:9508; X-Forefront-PRVS: 040866B734 X-MS-Exchange-SenderADCheck: 1 X-Microsoft-Antispam: BCL:0; X-Microsoft-Antispam-Message-Info: nFdiCJTwiKxdrmVL73XToO8PSNEVtDSHIID0FGxp/pio70XdAHQnWOxahZVYqDXNTBYVbQxWjGWi4S16EK4Qjokz9xe4dZtidjvFRauj9L90oAGj0KUx9PEXbq5GaNDTTicuTVGdsiuHyEl0ExnyVGqgE4Ymp13WkLIsckPGfQP4XgOEl2sjtZQyohBVAU13mMowwH9rt41g4q1HeVq+y+ZfI3bvMMNySZhO4qSECPzZvuO3E/v/2IxboJXplv5WbSSKLbwJh3/09ZbFIcNoMiwwcr8kykxDyoukcp7SPFWSeQRXd7PflyhygwFlqdJZOOPQk8kVIyu/EQMpgREVMALYvsfdwKqM2TluhoRBDlsV4BgnB/pDEcdptCm3nR+5MlX4WGAODh/bse3B+gDl3ucP5RzfX8UOJJTGcUcbkCT/VQ1+vkIMj5h2X30Q73TPfi0nVrd7VIjihv0yfo590DkM3K98uRU36owWzJq3scxbLD35UoeiC2u/H67DViqSWHObNrhLYEZdLjlookGwY7ofOhw7V60LwNR+97eKDDJ7umORxw6zPITxsuanUCwOW9r2j7UyhBQJKrW3YOknWQ== X-Forefront-Antispam-Report: CIP:255.255.255.255; CTRY:; LANG:en; SCL:1; SRV:; IPV:NLI; SFV:NSPM; H:OSBPR01MB2566.jpnprd01.prod.outlook.com; PTR:; CAT:NONE; SFTY:; SFS:(39840400004)(346002)(376002)(136003)(396003)(366004)(16526019)(26005)(8936002)(186003)(66476007)(66556008)(2616005)(66946007)(2906002)(31686004)(31696002)(6666004)(508600001)(86362001)(36916002)(8676002)(52116002)(956004)(316002)(16576012)(53546011)(786003)(966005)(66574014)(5660300002)(6486002)(43740500002); DIR:OUT; SFP:1102; X-MS-Exchange-AntiSpam-MessageData: cQac11HCccUNhZjDWorlydON2oL5k9wxlrV0kbzPKDPdoFmUb03+8EaMt5o2lp8UchoEt4BTXfO+FxFKtmo/LyC4yoDyL+yTdsvOL71kLfVzewiqVzcSdGQozqPF0dwI88utTQISYj+SbJFmAf9ZEGrzdT8TLsJG6WBn63iAXxoRFypXcNmyRaee7F9zEtvBy2kkAal9ZUd1ooEgJnXME1PZ9Ha/7yQUg57ALeBaV6IgNXPpalSbTG1n5web/v+Hy0uS6EpceEz3r3lbir+mK+iZa5ylo4RdM6tlZN7S3JtrpjmGzp2OEO1VFm0pSEgxfjxah3g6i5A3v2zYhA6DK+/YOZyp8ReJyHnFb7ICtVJJx9SX2SLWJ5eCb8zCqi8GBJswMEmxpE2Zsm0khGkqhppwTtCNtgBZHY7YXUvE0Qj/gH3nIit47Wh7C2xCe2XizhHg+imOy6FEfQ55PfQsEqk6ORVVojS/cj7WWxo0b74= X-OriginatorOrg: it.aoyama.ac.jp X-MS-Exchange-CrossTenant-Network-Message-Id: bc6f25a7-535c-4f27-1d52-08d7fbe8755c X-MS-Exchange-CrossTenant-OriginalArrivalTime: 19 May 2020 11:33:31.7369 (UTC) X-MS-Exchange-CrossTenant-FromEntityHeader: Hosted X-MS-Exchange-CrossTenant-Id: e02030e7-4d45-463e-a968-0290e738c18e X-MS-Exchange-CrossTenant-MailboxType: HOSTED X-MS-Exchange-CrossTenant-UserPrincipalName: 9IdrqrMo+nv6dDvxe9kdZcvhjBHPZ8bo3k6GLnzivaAEZ0c26MW09qFzZhjEkHKzsRq9lNsod5A/v2tfJ0kmew== X-MS-Exchange-Transport-CrossTenantHeadersStamped: OSBPR01MB1877 Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 19 May 2020 11:33:37 -0000 Hello Henry, others, On 19/05/2020 18:40, Henry S. Thompson wrote: > Timothy Mcsweeney writes: > >> This is a request for a review of the 'drop' URI scheme.  The >> draft can be found here > >> https://datatracker.ietf.org/doc/draft-mcsweeney-drop-scheme/ > > Without commenting on any other aspect of the proposed scheme, and > mostly just to save people time, I found the following aspect of the > proposal somewhat misleading: > > "Similar to the previously registered 'tel' [RFC3966] and > 'leaptofrogans' [RFC8589] URIs, the 'drop' URI scheme is > syntactically correct but does not need to use all 5 of the > parse-able components available to it. The 'drop' scheme uses the > number sign '#' as a general delimiter as seen in Appendix > A. Collected ABNF [RFC3986]. The scheme syntax is as follows: > > " drop-uri = 'drop#' character string > > drop # fg34htx > \__/ \_/ \_____/ > | | | > | > > " > > I read this as implying that > > 1) 'tel' and 'leaptofrogans' URIs did not begin "tel:" and > "leaptofrogans:"; > 2) The 3986 ABNF for URIs recognises "drop#fg34htx" as a URI. > > Neither of these is in fact that case. The two referenced schemes > require ':' after the 'scheme' component, and the 'URI' production does > _not_ recognise the above example. (The 'URI-reference' production does, > but not using the 'scheme' production to cover the "drop" part.) Yes, and on top of that, if ever the "drop" part would be recognized as a scheme (which, as explained, it isn't), a browser resolving a drop URI would wait for all of the 'drop' resource to be downloaded before identifying the fragment identified by the #fg34htx part. As explained in various places, a fragment identifier is interpreted after obtaining the primary resource, and using the rules for the media type of the primary resource. Without some major redesign, this 'drop scheme' looks like a non-starter, sorry. Regards, Martin. > ht > From nobody Tue May 19 08:46:22 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id B3BAB3A0863 for ; Tue, 19 May 2020 08:46:19 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -0.117 X-Spam-Level: X-Spam-Status: No, score=-0.117 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, DKIMWL_BL=1.979, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, DKIM_VALID_EF=-0.1, FREEMAIL_FROM=0.001, HTML_MESSAGE=0.001, RCVD_IN_DNSWL_BLOCKED=0.001, SPF_HELO_NONE=0.001, SPF_PASS=-0.001, URIBL_BLOCKED=0.001] autolearn=no autolearn_force=no Authentication-Results: ietfa.amsl.com (amavisd-new); dkim=pass (2048-bit key) header.d=gmail.com Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id HMcE8iSU04MJ for ; Tue, 19 May 2020 08:46:17 -0700 (PDT) Received: from mail-ot1-x329.google.com (mail-ot1-x329.google.com [IPv6:2607:f8b0:4864:20::329]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 2C8423A0783 for ; Tue, 19 May 2020 08:46:17 -0700 (PDT) Received: by mail-ot1-x329.google.com with SMTP id c3so11409699otr.12 for ; Tue, 19 May 2020 08:46:17 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=CLWPqXgEmRTYf7Wz3+xQAgJPUWURkd382w4Az6qfYe4=; b=OPFO1DAruY3YuvcdnQtCeCGsqjdNLK3td129/EK/cZiW0oi7RCzZAksEtD7SgOz8jw Dy5ui3DhhCGceXHk68hnVEu+qJqoGDit2rb2w4Gg81ecpC+q3Y0RyJ2xL6vdM/FJSD8w cVG22dNlRXMekdeOcs8WiHwb9NkD5RFOzcBLIvoGft17UrYFmVBeD5ujKKEO8d6tNQIF LzsLV8632vxrOaeQan6RUWdiwNQEqfPgkWgObQNF5yj+QpFM90TYNSsbE2bi7LKQsfIp s6iU17+s8zVkm3KNLyCmqIMl/G7f67Ix+YXM49k40jugbY9E9ywUvBRhPSgrPJgbB/Gz D7Lw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=CLWPqXgEmRTYf7Wz3+xQAgJPUWURkd382w4Az6qfYe4=; b=BmwoF3RsNeFY7bfh9G3Oxs3yrEwhdK2kzRAY5v6BZXayduvT8l7/opZzD5X8D+CHh8 EOJxO6qbILmSYDCSJ7fiFSuJbPqwcwCqa2GAKr9QjLhAIXpGilyLSKfQRvqj6pXLW35v QHywQChKCIv+/6P760A7XQkJIj4Gy8MVcs050sFKqr4P7ZY4yN5EDbYeGfo6Pgq0Mq2v hKxzpJIrJDpLHZ0aDLf6sxY+8rWAgGh80cN92Uo4wVPwdUD6/aVX1QF/v7clc/Ub01y1 kUDpyjKc532wMmSZC5nEe2x93m4PlcQSLO7jWmh63p9Z8RPhZf43ddxc565qaYiIvMj8 KBHg== X-Gm-Message-State: AOAM532WZBWLBnerFxEcfwO26SZYnhLwu2hBE+W7O/Ntq5cQTCtHNtKd ECzXq+jIwjFeGAQGY0iJheBKYJYd0IOoAJvYGTM= X-Google-Smtp-Source: ABdhPJyEN4AE5vG5PiYJoamH+J5ZebpasimCxivrdxotAQ2jdn8LJGLTYuUEXiwruLcHZnD3DcmYSdHm/tgqAvlknBU= X-Received: by 2002:a9d:544:: with SMTP id 62mr16629526otw.165.1589903176135; Tue, 19 May 2020 08:46:16 -0700 (PDT) MIME-Version: 1.0 References: <491516506.246380.1589851279474@email.ionos.com> In-Reply-To: <491516506.246380.1589851279474@email.ionos.com> From: Ted Hardie Date: Tue, 19 May 2020 08:45:33 -0700 Message-ID: To: Timothy Mcsweeney Cc: uri-review@ietf.org Content-Type: multipart/alternative; boundary="0000000000000a775c05a6022ea7" Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 19 May 2020 15:46:20 -0000 --0000000000000a775c05a6022ea7 Content-Type: text/plain; charset="UTF-8" Hi Tim, Thanks for the pointer to the draft. I think there are two issues here which are large enough that you may wish to think about the implied architecture. The first is a syntactic issue: the use of "#" as the only delimiter in the proposed URIs. As RFC 3986 describes it, the "#" delimiter is used for identifying fragments and is thus dependent on the MIME type of the retrieved object: The fragment's format and resolution is therefore dependent on the media type [RFC2046 ] of a potentially retrieved representation, even though such a retrieval is only performed if the URI is dereferenced. This does not appear to match your usage. The usage you appear to be seeking is a transposition of the string to a subdomain of a well-known domain, so that a client can attempt retrieval via the three methods you enumerate; it is not clear from the document whether there will ever be more than one permitted domain here. A simpler implementation would appear to be drop:drop-string.well-known-domain.example. Second, your document appears to imply that the drop string is used to augment existing telephone numbers and addresses, but it is not terribly clear how it does this. One interpretation might be that the drop-string functions as a permanent identifier with the current telephone number, address, or other contact methods being available as a retrieved resource. This section: Primarily functioning as a locator there are three ways to get to a 'drop' URI resource, http, srv records, and private resolution for anything not found using the previous two methods. The first, or default, action is when an application invokes the 'drop' URI it will cause a lookup for matching application information starting with an A record [RFC1035], then on to Service records [RFC2782], and then on to other available records that may offer a new rule set for resolution. raises a problem with this approach: the records returned by SRV are fundamentally different, in that they are onward pointers to other domains and resolutions. If the implication is that HTTP is always used to retrieve drop records and the appropriate server is discovered by either using an A record, an SRV record, or private resolution, then this section needs a major re-write (to include AAAA records and to clarify the intent). It's also not clear what long lived utility a new scheme serves here if the result is always https://some-string.discovered-domain.example/ . If there were a different guarantee of uniqueness than the DNS, this would seem closer to a URN than other URI forms, or possibly an implementation of the handle system (as DOIs are). There is, unfortunately, not enough detail in the draft on the overall system to be confident of that. regards, Ted Hardie On Mon, May 18, 2020 at 6:21 PM Timothy Mcsweeney wrote: > Hello everyone, > > This is a request for a review of the 'drop' URI scheme. The draft can be > found here < https://datatracker.ietf.org/doc/draft-mcsweeney-drop-scheme/>. > Thank you. > > Sincerely, > Tim McSweeney > _______________________________________________ > Uri-review mailing list > Uri-review@ietf.org > https://www.ietf.org/mailman/listinfo/uri-review > --0000000000000a775c05a6022ea7 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
Hi Tim,

Tha= nks for the pointer to the draft.=C2=A0 I think there are two issues here w= hich are large enough that you may wish to think about the implied architec= ture.=C2=A0 The first is a syntactic issue:=C2=A0 the use of "#" = as the only delimiter in the proposed URIs.=C2=A0=C2=A0 As RFC 3986 describ= es it, the "#" delimiter is used for identifying fragments and is= thus dependent on the MIME type of the retrieved object:

   The fragment's format and resol=
ution is therefore
   dependent on the media type [RFC2046] of a potentially retrieved
   representation, even though such a retrieval is only performed if the
   URI is dereferenced.
This does not appear to match your us= age. The usage you appear to be seeking is a transposition of the string to= a subdomain of a well-known domain, so that a client can attempt retrieval= via the three methods you enumerate; it is not clear from the document whe= ther there will ever be more than one permitted domain here.=C2=A0 A simple= r implementation would appear to be drop:drop-string.well-known-domain.exam= ple.

Second, your document appears to imply that t= he drop string is used to augment existing telephone numbers and addresses,= but it is not terribly clear how it does this.=C2=A0 One interpretation mi= ght be that the drop-string functions as a permanent identifier with the cu= rrent telephone number, address, or other contact methods being available a= s a retrieved resource.=C2=A0 This section:
Primarily functi=
oning as a locator there are three ways to get to a
'drop' URI resource, http, srv records, and private resolution for
anything not found using the previous two methods.  The first, or
default, action is when an application invokes the 'drop' URI it wi=
ll
cause a lookup for matching application information starting with an A
record [RFC1035], then on to Service records [RFC2782], and then on to
other available records that may offer a new rule set for resolution.
raises a problem with this approach:=C2=A0 the records returned= by SRV are fundamentally different, in that they are onward pointers to ot= her domains and resolutions.=C2=A0 If the implication is that HTTP is alway= s used to retrieve drop records and the appropriate server is discovered by= either using an A record, an SRV record, or private resolution, then this = section needs a major re-write (to include AAAA records and to clarify the = intent).=C2=A0 It's also not clear what long lived utility a new scheme= serves here if the result is always https://some-string.discovered-domain.example/ .= =C2=A0

If there were a different guarantee of uniqueness than the = DNS, this would seem closer to a URN than other URI forms, or possibly an i= mplementation of the handle system (as DOIs are).=C2=A0 There is, unfortuna= tely, not enough detail in the draft on the overall system to be confident = of that.

regards,

Ted Hardie


On Mon, May 18, 2020 at 6:21 PM Timothy Mcsweeney <tim@dropnumber.com> wrote:
=20 =20 =20
Hello everyone,=C2=A0

This is a request for a review of the 'drop' URI scheme.=C2=A0 T= he draft can be found here <=20 https://datatracker.ietf.org/doc/draft-mcsweeney-drop-s= cheme/>.=C2=A0 Thank you.=C2=A0

Sincerely,=C2=A0
Tim McSweeney
=20
_______________________________________________
Uri-review mailing list
Uri-review@ietf.or= g
https://www.ietf.org/mailman/listinfo/uri-review=
--0000000000000a775c05a6022ea7-- From nobody Tue May 19 08:47:05 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 358693A0783 for ; Tue, 19 May 2020 08:47:03 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.798 X-Spam-Level: X-Spam-Status: No, score=-1.798 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, HTML_MESSAGE=0.001, MIME_HTML_ONLY=0.1, RCVD_IN_MSPIKE_H2=-0.001, SPF_NONE=0.001, URIBL_BLOCKED=0.001] autolearn=no autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id H8Hn95vfWfBg for ; Tue, 19 May 2020 08:47:01 -0700 (PDT) Received: from mout.perfora.net (mout.perfora.net [74.208.4.196]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 968AA3A08CD for ; Tue, 19 May 2020 08:47:01 -0700 (PDT) Received: from oxusgaltgw15.schlund.de ([10.72.72.62]) by mrelay.perfora.net (mreueus003 [74.208.5.2]) with ESMTPSA (Nemesis) id 0M4G3R-1ijEwx3Vgp-00rnIo for ; Tue, 19 May 2020 17:47:00 +0200 Date: Tue, 19 May 2020 11:47:00 -0400 (EDT) From: Timothy Mcsweeney Reply-To: Timothy Mcsweeney To: uri-review@ietf.org Message-ID: <1516971670.87548.1589903220738@email.ionos.com> In-Reply-To: References: <491516506.246380.1589851279474@email.ionos.com> MIME-Version: 1.0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: 7bit X-Priority: 3 Importance: Normal X-Mailer: Open-Xchange Mailer v7.10.1-Rev30 X-Originating-Client: open-xchange-appsuite X-Provags-ID: V03:K1:cUKpPG2IsJ6/FCOhI3KkhJKIM5dh15rmVEVfjS8+J0ha7STY8vq oVVdoepUVf2dxnWYDhyw5wggRQaw/aNz4uzFiwH9JqGBx8aM2BWLV62eLfu94zZ60a+SoNQ aqyj0/7w7+7VjsliPUopZbZMhk4UXSeo/CQpeEnvf7IhDK0UK5uEZBafQRRWYcOevIpsH71 IY/qBJDSgwOsP56QIY/+A== X-UI-Out-Filterresults: notjunk:1;V03:K0:97LCiEA5pLI=:6xKnnn2UnCqzAIZ60gXw7x vsnq//+f3+91HE4PCW5m4f+DLEdSP1CCcM+/9yT+qrVyMu4w+Lf5jjSEunzOhLntL5e4wPT/f m85Zudf8ncjWMzKiG46fJg3I+ND7TtGp5TtDMCkDWK8dyrDJYnZ20BdYZX22TJjL5LO50lZR0 twqi5j9O5+uvShkz1aX+0Gcm8tPiUXm4OaWBXfqluYyTxnW5jAiQ9KEB117UFwS1YY8a/4TeB cGQDa1ZhZfegrVf6yL07Aez4jfePm71q4jC/A5HBmtHfpYYa2PB1v6VnLNV7ATYVhi1PCzUIv DQtBDOCW/wTLqtpD5JZgvlMxruQDLFKf6LrBKFVVsXst2eIgJ3RK1BWSVhfpcOD57CHcdV9o9 YeuJqxRzwa8iC0VFK5zNMN1Q3PcinJx3j7t9xv3h5ckSw8sPVvtq/xJdd7gVEWgQXkPAuN7Hy mcT4Q36ZuMKs1VIbFZRPAK07cXjw9gMIJO3onmU6Z11e3RmMK15E/TrJXxZf/31W4CiCoremo QUtD134cQIbL9FIfkgw6mNUY56fxc2SzlfGO+NutiLh+/+i3wd6m+HYnnZ+rLUayqsKf0/LLd ulop9/1bXfnoYHhras9EAmEJU3z8+hr5DzxYbNZaWyddgRjhZHC7FYnY5Hm0jud3xG3zouK/7 VsSvzb+54WPXXV2zgMu++HT63kfNObZaNa82Dy3ntpoRH9CcU0ijfdPJQ8Ikfud6vxmFAjk12 zLAfe9azNWAv1fMSlwnkUD1QH/P5Rm57IYVrMVe0+VVYvQwYOvHKxeQL69ncXNjegFBi08DK+ yk2YibRd9Cb0Wjef1NY/QomtHYWLUYlDQAJUg9BTtgV7j60gXdRlNLRtpQhJ9d1SNXGbB2M Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 19 May 2020 15:47:03 -0000
Hi Henry,
I apologize for anything that was misleading as that was certainly not my intent. I will separate those two statements. The only similarity I wanted to point out was that 'tel' and 'leaptofrogans' use less than all five scheme components. Perhaps 'geo:' would have been a better example?

For the syntax, I wasn't sure exactly how much info was needed. I thought that only the scheme and path were required. Maybe I could change the reference to [RFC3986] section 2.2? If you think it would be better, should I write it out more like this?

path = / path-noscheme ; begins with a non-colon segment
          / path-rootless ; begins with a segment
          / path-empty ; zero characters

path-noscheme = segment-nz-nc *( "/" segment )
path-rootless = segment-nz *( "/" segment )
path-empty = 0<pchar>

segment = *pchar
segment-nz = 1*pchar
segment-nz-nc = 1*( unreserved / pct-encoded / sub-delims / "@" )
                       ; non-zero-length segment without any colon ":"

pchar =      unreserved / pct-encoded / sub-delims / ":" / "@"


Hi Martin,
I know at first glance it might look out of place but the #fg34htx part isn't a fragment. I think the "drop" part will be recognized as the scheme name because of its dereferencing.


On May 19, 2020 at 5:40 AM "Henry S. Thompson" < ht@inf.ed.ac.uk> wrote:


Timothy Mcsweeney writes:

This is a request for a review of the 'drop' URI scheme.  The
draft can be found here
Without commenting on any other aspect of the proposed scheme, and
mostly just to save people time, I found the following aspect of the
proposal somewhat misleading:

"Similar to the previously registered 'tel' [RFC3966] and
'leaptofrogans' [RFC8589] URIs, the 'drop' URI scheme is
syntactically correct but does not need to use all 5 of the
parse-able components available to it. The 'drop' scheme uses the
number sign '#' as a general delimiter as seen in Appendix
A. Collected ABNF [RFC3986]. The scheme syntax is as follows:

" drop-uri = 'drop#' character string

drop # fg34htx
\__/ \_/ \_____/
| | |
<scheme> | <scheme-specific-part>
<gen-delim>
"

I read this as implying that

1) 'tel' and 'leaptofrogans' URIs did not begin "tel:" and
"leaptofrogans:";
2) The 3986 ABNF for URIs recognises "drop#fg34htx" as a URI.

Neither of these is in fact that case. The two referenced schemes
require ':' after the 'scheme' component, and the 'URI' production does
_not_ recognise the above example. (The 'URI-reference' production does,
but not using the 'scheme' production to cover the "drop" part.)

ht
--
Henry S. Thompson, School of Informatics, University of Edinburgh
10 Crichton Street, Edinburgh EH8 9AB, SCOTLAND -- (44) 131 650-4440
Fax: (44) 131 650-4587, e-mail: ht@inf.ed.ac.uk
[mail from me _always_ has a .sig like this -- mail without it is forged spam]

The University of Edinburgh is a charitable body, registered in
Scotland, with registration number SC005336.

_______________________________________________
Uri-review mailing list
From nobody Tue May 19 23:25:30 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id D70EC3A3ADC for ; Tue, 19 May 2020 23:25:28 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.9 X-Spam-Level: X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, MSGID_FROM_MTA_HEADER=0.001, RCVD_IN_MSPIKE_H2=-0.001, SPF_PASS=-0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no Authentication-Results: ietfa.amsl.com (amavisd-new); dkim=pass (1024-bit key) header.d=itaoyama.onmicrosoft.com Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id R81ejoPFNGq6 for ; Tue, 19 May 2020 23:25:25 -0700 (PDT) Received: from JPN01-OS2-obe.outbound.protection.outlook.com (mail-eopbgr1410103.outbound.protection.outlook.com [40.107.141.103]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 625F53A3AD7 for ; Tue, 19 May 2020 23:25:24 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=ihZu4VrR5sFlaP/liIaU0DwVmjqErtccsXmxL1Bbc9HY16KObWCIfZcGpwNNVjkDqv+SEyoD/bIrS+uQeLs9U/xpsRtH71jk+l/pHM/spJXbZk5cM34WsMoPvRCzGGrOWmc4ZiXOx5IK+e7e5IDXAIniCjuTxm8928tVvHDh62JPllEB3wO5tzVelWsNX4379NffiwazmkLRuS44s1FFogAUSeZYeewkuPdHfyshpa6Rb9Sb2K2pahCOy9TNzV4o3yzShSlR0bwLqWnVGT3hWkVxZ3DcS7Ek2FQK9kPeEsH2ArFQK0BZ6grg/Bwzv+za36S+IUBsRr9PbD5sznxddg== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=wEW+RuaE0AstObs2k5zYHN2qrYPksY9SRB96l2Y+fAo=; b=C5nU42xJPEUT/zj5Eqt0Q1X+DypCPHkslnWIjhINdgTFQhrWBO4LueunlvjvXJeG0+rPK8GBZsq+wy1chxjUgqmrvUGJ4BLW1bOh/aN3jDW9mLPrS0x//ulv0qbAmABWLBdbo7KInIH3udqnEewOtpXkEMRG6fwnhzY2jgF5qysYlMmEsoiPGYUC/xQNidJpNhuCf9ZbOBuS4JXYJT1SZcyKRcrZLgVuusd+vuP/XTLO2zViIjqnZ5z0GfjZii1OWwp+FBAhnvwZ5UJVSg3+N9VkFpsXQf3BiBLkOkYIbSRwb1VG0/w61mnkT38mLIA/kuUcDACf1vXgDvXa0JX9IQ== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=pass smtp.mailfrom=it.aoyama.ac.jp; dmarc=pass action=none header.from=it.aoyama.ac.jp; dkim=pass header.d=it.aoyama.ac.jp; arc=none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=itaoyama.onmicrosoft.com; s=selector2-itaoyama-onmicrosoft-com; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=wEW+RuaE0AstObs2k5zYHN2qrYPksY9SRB96l2Y+fAo=; b=tZdxIcdV5h47Ns0/x2l19GbQMSyPoYqUdvImEyo8G/sgnREv/KRDCdz+3X9saqkeAeH/aoS0nK40OaIo3ezz4E4yJ05ThQR+QJHH14Q109Anid+qSyhNcgLm+3Vt+mItVM/yeGsVz7ezRv9IWcffs5Kf5HAZ6Kcij9dC2Q0IUoo= Authentication-Results: ietf.org; dkim=none (message not signed) header.d=none;ietf.org; dmarc=none action=none header.from=it.aoyama.ac.jp; Received: from OSBPR01MB2566.jpnprd01.prod.outlook.com (2603:1096:604:1c::13) by OSBPR01MB2135.jpnprd01.prod.outlook.com (2603:1096:603:23::16) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.3000.26; Wed, 20 May 2020 06:25:23 +0000 Received: from OSBPR01MB2566.jpnprd01.prod.outlook.com ([fe80::80a8:73bf:9ca8:7aae]) by OSBPR01MB2566.jpnprd01.prod.outlook.com ([fe80::80a8:73bf:9ca8:7aae%5]) with mapi id 15.20.3021.020; Wed, 20 May 2020 06:25:23 +0000 To: Timothy Mcsweeney , uri-review@ietf.org References: <491516506.246380.1589851279474@email.ionos.com> <1516971670.87548.1589903220738@email.ionos.com> From: =?UTF-8?Q?Martin_J=2e_D=c3=bcrst?= Organization: Aoyama Gakuin University Message-ID: Date: Wed, 20 May 2020 15:25:20 +0900 User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; rv:68.0) Gecko/20100101 Thunderbird/68.8.0 In-Reply-To: <1516971670.87548.1589903220738@email.ionos.com> Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 8bit X-ClientProxiedBy: TYAPR01CA0088.jpnprd01.prod.outlook.com (2603:1096:404:2c::28) To OSBPR01MB2566.jpnprd01.prod.outlook.com (2603:1096:604:1c::13) MIME-Version: 1.0 X-MS-Exchange-MessageSentRepresentingType: 1 Received: from [192.168.1.6] (125.203.82.4) by TYAPR01CA0088.jpnprd01.prod.outlook.com (2603:1096:404:2c::28) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.2979.27 via Frontend Transport; Wed, 20 May 2020 06:25:22 +0000 X-Originating-IP: [125.203.82.4] X-MS-PublicTrafficType: Email X-MS-Office365-Filtering-Correlation-Id: 901b81ee-be16-4e50-3298-08d7fc86938c X-MS-TrafficTypeDiagnostic: OSBPR01MB2135: X-Microsoft-Antispam-PRVS: X-MS-Oob-TLC-OOBClassifiers: OLM:9508; X-Forefront-PRVS: 04097B7F7F X-MS-Exchange-SenderADCheck: 1 X-Microsoft-Antispam: BCL:0; X-Microsoft-Antispam-Message-Info: xi/caXdera8Jg05eO5TjM+RZNya9FWtEnKGF1BgvLAciwV2gy9naBCdgUWwWs407he/dRRkGVVM0I25NIpI8uDKF85L4HeIkYQ7H7lTIoZ9NjRIrRPQPz8a+TAkvEqa5M1sz5X5lxumdJe1KziiEXbgeaSyxl5QZ4+s173VwEAt3KIoN3Gsy0HoKOKSrxVZ0nk1e61OYzfSwS6tEzCw7TShhDO6VPDOY8Vixlg5htec5Kd2bsLeGY2n0NFY1YyAlQ5716Ro0h9sRfhx7gcBBz0X8IsjgeUoY7UnHsCA+loXV29c1m/ePhjuOQifqHgLViluGn0d9sbtwxJBB7+qx3MTNSagt32UTpIAvCXbhA17MGxJGEhRwKfXJ5JMCoKTHHNT/7okE9caUdKRHJvxGhtGIy5Q8FMljjNc0sh83rQi4jX/atmy1AA6+sWsa3tErE8bFFwdwWMeDvz8vFBswQx95Rlb791WG4fhsMUe2zfRLYogA9lPFDFdXfM2DrwCH85e7rggr2K4SaUVhgmbn/K+0QAQrA4/hv52/NJseEoOa8QIcznzTZn7D4v6NN23obVODLL1ib9+L8LJOdful0w== X-Forefront-Antispam-Report: CIP:255.255.255.255; CTRY:; LANG:en; SCL:1; SRV:; IPV:NLI; SFV:NSPM; H:OSBPR01MB2566.jpnprd01.prod.outlook.com; PTR:; CAT:NONE; SFTY:; SFS:(366004)(346002)(396003)(39840400004)(376002)(136003)(86362001)(8936002)(16526019)(186003)(8676002)(52116002)(36916002)(31696002)(66574014)(966005)(66946007)(66476007)(26005)(66556008)(508600001)(2616005)(5660300002)(2906002)(956004)(53546011)(6486002)(31686004)(316002)(786003)(16576012)(43740500002); DIR:OUT; SFP:1102; X-MS-Exchange-AntiSpam-MessageData: wR9Be6HJh5F2A7k73tsfJcm+/IECaV68BpJlSPq4wzii0pKCKlUgTmfE6mo+NxbS17S2U57/qRtsPt9WZj1GRqWEpDp+xdxK9qaryDmJWozHBEADYI05p84y+71a/E/SA6Z7jkkak9UZloR4QVngJLU0zd2nDugX13hmevZ1MUq/CcCd2cT05Txctsg283rX/wnKrAD3BR54ZgcwKj6vF9QrdcTW2W0R/88DQJ4rSzO7cn2RVFr8MZMlGbkNrOteZ30hYOsLQfREjJ2DYtSvEUQhcsbS6wVBgsQqkqrSRlanuFCyXhCzBgucvMWRVa687GX7RXnTI0beAfPVWRW7iajPgzeJJsyBXPc7DsIw7ycDXX5SXA9wmhR0vuFACLMIYHOkXBYz2nMFj0OMQRIODIYT4d12IHXy3pEqa6/qSUONEzDVe+JX00tH5zuLUmTNKzbkLeaGP1gKPCk9TreSvmmrzWUODbBpT0qS40KYnck= X-OriginatorOrg: it.aoyama.ac.jp X-MS-Exchange-CrossTenant-Network-Message-Id: 901b81ee-be16-4e50-3298-08d7fc86938c X-MS-Exchange-CrossTenant-OriginalArrivalTime: 20 May 2020 06:25:22.9669 (UTC) X-MS-Exchange-CrossTenant-FromEntityHeader: Hosted X-MS-Exchange-CrossTenant-Id: e02030e7-4d45-463e-a968-0290e738c18e X-MS-Exchange-CrossTenant-MailboxType: HOSTED X-MS-Exchange-CrossTenant-UserPrincipalName: bkKxoigPgPdMIRQMwN0131qV2tO/dzmjprLwxSWp5CA2YvA6oSIQWYefDQn2xzS3ybTrP0gduVPXaOyyyp5i1Q== X-MS-Exchange-Transport-CrossTenantHeadersStamped: OSBPR01MB2135 Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 20 May 2020 06:25:29 -0000 Hello Timothy, On 20/05/2020 00:47, Timothy Mcsweeney wrote: > Hi Henry, > I apologize for anything that was misleading as that was certainly not my > intent. I will separate those two statements. The only similarity I wanted to > point out was that 'tel' and 'leaptofrogans' use less than all five scheme > components. Perhaps 'geo:' would have been a better example? > > For the syntax, I wasn't sure exactly how much info was needed. I thought that > only the scheme and path were required. Maybe I could change the reference to > [RFC3986] section 2.2? If you think it would be better, should I write it out > more like this? In the extreme, only the scheme is needed. "dav:" is an example. But without a colon, it's not a scheme. > path = / path-noscheme ; begins with a non-colon segment > / path-rootless ; begins with a segment > / path-empty ; zero characters > > path-noscheme = segment-nz-nc *( "/" segment ) > path-rootless = segment-nz *( "/" segment ) > path-empty = 0 > > segment = *pchar > segment-nz = 1*pchar > segment-nz-nc = 1*( unreserved / pct-encoded / sub-delims / "@" ) > ; non-zero-length segment without any colon ":" > > pchar = unreserved / pct-encoded / sub-delims / ":" / "@" I'm not sure what these parts of the grammar are supposed to do here, but you can't just start in the middle of the grammar and claim that you get an URI. > Hi Martin, > I know at first glance it might look out of place but the #fg34htx part isn't a > fragment. By the definitions of RFC 3986, it is a fragment (identifier). This is independent of what you want to call it. > I think the "drop" part will be recognized as the scheme name because > of its dereferencing. Please do the following, as an easy experiment: - Create a simple Web page somewhere, e.g. called base.html, and in it, include the following part: Link to drop URI - In the same directory, create another Web page, with the file name simply being 'drop' (without extension). Way down in that Web page, include the following: Fragment fg34htx - Activate the link in the first page, and observe how it goes to the fragment in the second page. [If you set up the pages on the server, you may have to take some care that the 'drop' file is really served with an HTML media type; this may be a bit tricky.] If my explanations don't help, maybe doing this experiment will show you what I mean. Regards, Martin. P.S.: The solution is simple. If you change "drop#fg34htx" to "drop:fg34htx", then you actually match the URI production and no longer have a fragment id. >> On May 19, 2020 at 5:40 AM "Henry S. Thompson" < ht@inf.ed.ac.uk >> > wrote: >> >> >> Timothy Mcsweeney writes: >> >>> This is a request for a review of the 'drop' URI scheme. The >>> draft can be found here >>> https://datatracker.ietf.org/doc/draft-mcsweeney-drop-scheme/ >> Without commenting on any other aspect of the proposed scheme, and >> mostly just to save people time, I found the following aspect of the >> proposal somewhat misleading: >> >> "Similar to the previously registered 'tel' [RFC3966] and >> 'leaptofrogans' [RFC8589] URIs, the 'drop' URI scheme is >> syntactically correct but does not need to use all 5 of the >> parse-able components available to it. The 'drop' scheme uses the >> number sign '#' as a general delimiter as seen in Appendix >> A. Collected ABNF [RFC3986]. The scheme syntax is as follows: >> >> " drop-uri = 'drop#' character string >> >> drop # fg34htx >> \__/ \_/ \_____/ >> | | | >> | >> >> " >> >> I read this as implying that >> >> 1) 'tel' and 'leaptofrogans' URIs did not begin "tel:" and >> "leaptofrogans:"; >> 2) The 3986 ABNF for URIs recognises "drop#fg34htx" as a URI. >> >> Neither of these is in fact that case. The two referenced schemes >> require ':' after the 'scheme' component, and the 'URI' production does >> _not_ recognise the above example. (The 'URI-reference' production does, >> but not using the 'scheme' production to cover the "drop" part.) >> >> ht >> -- >> Henry S. Thompson, School of Informatics, University of Edinburgh >> 10 Crichton Street, Edinburgh EH8 9AB, SCOTLAND -- (44) 131 650-4440 >> Fax: (44) 131 650-4587, e-mail: ht@inf.ed.ac.uk >> URL: http://www.ltg.ed.ac.uk/~ht/ >> [mail from me _always_ has a .sig like this -- mail without it is forged spam] >> >> The University of Edinburgh is a charitable body, registered in >> Scotland, with registration number SC005336. >> >> _______________________________________________ >> Uri-review mailing list >> Uri-review@ietf.org >> https://www.ietf.org/mailman/listinfo/uri-review > > > _______________________________________________ > Uri-review mailing list > Uri-review@ietf.org > https://www.ietf.org/mailman/listinfo/uri-review > -- Prof. Dr.sc. Martin J. Dürst Department of Intelligent Information Technology College of Science and Engineering Aoyama Gakuin University Fuchinobe 5-1-10, Chuo-ku, Sagamihara 252-5258 Japan From nobody Wed May 20 14:38:45 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id F1BE53A02BB for ; Wed, 20 May 2020 14:38:38 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.795 X-Spam-Level: X-Spam-Status: No, score=-1.795 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, HTML_MESSAGE=0.001, MIME_HTML_ONLY=0.1, RCVD_IN_MSPIKE_H3=0.001, RCVD_IN_MSPIKE_WL=0.001, SPF_NONE=0.001, URIBL_BLOCKED=0.001] autolearn=no autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id MA8PPhMF_1Ec for ; Wed, 20 May 2020 14:38:37 -0700 (PDT) Received: from mout.perfora.net (mout.perfora.net [74.208.4.194]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 177343A00D9 for ; Wed, 20 May 2020 14:38:36 -0700 (PDT) Received: from oxusgaltgw06.schlund.de ([10.72.72.52]) by mrelay.perfora.net (mreueus002 [74.208.5.2]) with ESMTPSA (Nemesis) id 0MN2Bq-1ji9Bc17Ga-006bMk for ; Wed, 20 May 2020 23:38:36 +0200 Date: Wed, 20 May 2020 17:38:36 -0400 (EDT) From: Timothy Mcsweeney Reply-To: Timothy Mcsweeney To: uri-review@ietf.org Message-ID: <122709156.27676.1590010716156@email.ionos.com> In-Reply-To: References: <491516506.246380.1589851279474@email.ionos.com> <1516971670.87548.1589903220738@email.ionos.com> MIME-Version: 1.0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-Priority: 3 Importance: Normal X-Originating-Client: open-xchange-appsuite X-Mailer: Open-Xchange Mailer v7.10.1-Rev31 X-Provags-ID: V03:K1:mJAtLpK4hsZxErC5nzhLIxweUQhS86lRXmDxqqVqabUiYIPh4ln WMuN9381o29x7Uefz/nLn0OyOL2HDBAUysIpoHSevxVGlQDgsAI9HBHI13tB/90i1bmSP8H 3Gwof7D8D5pJs4xaYUqgu70PQ546YrqAlzm6SavkB90bdpAsIcahcYNttC8OKl8TfLCLOuN hOOkqnJSe7GmbN1gbJ5Iw== X-UI-Out-Filterresults: notjunk:1;V03:K0:oPYCtclYQnY=:IN4r/qV3RlTTw+tInWzqCY GYYtduFD6uOzwfRZ0v9Jn1nPW2JFmUvfrbsn6HEADLUy7AqlY59DdS3pR+4LRg76VhvGFEd8b yRlDiNnywyItgAxKE+4qzvMJ9KpUtJvClu3ixUo1dre/Yh0P3F6UYQMy/z3DRUvy8PTBITWwn +uW6G5Xb/0Ll3B6QZoIant60amX2JzprzXXEXESVSBIxXa8CcWSjB1nJBaB31+smVo0ool7LY EtXb3F90ixtE+ywqwicoP+np+ND72pQ8hjiCJIblv29ooN1Y4CtxZmlxYeYyBCh6nkLobtz8U RkQP0UOAs1dLJpk0FIMMrXBWU7WjWkqDk5aGrrYz+ML/Cme0DYz7zsWmIm8a5Dt96xdlPDGJc 3aUt5z1vbY3S8QjMFX68/v9Y7yqBdBm1QE//9zwMwG5PYiBWlJh7kKYLy9m/nRJNd8lnrw4QY 4Q1SUSYajRbJkCyqHXSGwiClBOq5ggQmhh9K+CTBfw59WgIAkXqz2fqCsYhUDNgiLtXhsvrFL 3g7Cl4k+UWyXSh+zALRLy/IiKbzaxbUFKn+HrVVXMwX8/MeKtHsh8CAIBCnrljEz0tvzSGNud UQR80hW0VU72iCs2m3gATpEl7hHHHKeBdRSAmPBbuDsEfhwb8vUCuF4dXpEd0kMSmM6JhG3EG poCu5YZw9MC5vR0Ajgub8zoEBdtYuEpKHFw8vhevNGlxzcY+xpKscxuEGG1TF8Ko/lzQGG7Jv C6RuaaaU82TqqY4pcKm4byey6qcL58YL6sWiLoTHrE+LoM54YPz923bRGAZl+vb3rRYQscAsr GnkqoPl6+APP3RyRdD9KE8bhgqCfJvJksw1rLl0bMHIB55Y8Ibzt95trRHL+kVgG6Jl82Nt Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 20 May 2020 21:38:39 -0000 =20 =20
Hi Martin,

I followed your instructions and I could not recreate what you wanted m= e to see.
Here are the two pages I made:

<http://www.soupsdeli.com/base.html>
<http://www.soupsdeli.com/drop>

Perhaps it had something to do with the hosting provider??  I'm no= t sure what's wrong here.  

Anyways, I'm glad to be here doing this.  Being an outsider, I was= very nervous about a review on this proposed scheme because everyone on th= is mailing list is 1000X more knowledgeable than me.  I thought for su= re that this review process was going to be a good way for the IETF crowd t= o blast my ignorance and be rid of me for a long while.

Just getting past the nits checker was a bit of a challenge for me.&nbs= p; But I have come to realize the real value in airing things out early is = the advantage of perspective.  I suspected I already knew the outcome = of your experiment, but not wanting to discount other ideas too quickly&nbs= p;is something I could use more practice with.  And I'm glad I tried i= t.  Seeing things with a more open mind helped me find an error in thi= s first draft that I haven't been called out on yet! (will be fixing that i= n draft-01).  So I am already grateful.

Maybe we could do a different experiment?  Maybe you know of a way= for me to try out my dereferencing and test the "#" as a delimiter?

Sincerely, 
Tim



On May 20, 2020 at 2:25 AM "Martin J. D=C3=BCrst" <=20 duerst@it.aoyama.ac.jp>= ; wrote:


Hello Timothy,

On 20/05/2020 00:47, Timothy Mcsweeney wrote:
Hi Henry,
I apologize for anything that was misleading as that was certainly not= my
intent. I will separate those two statements. The only similarity I wa= nted to
point out was that 'tel' and 'leaptofrogans' use less than all five sc= heme
components. Perhaps 'geo:' would have been a better example?

For the syntax, I wasn't sure exactly how much info was needed. I thou= ght that
only the scheme and path were required. Maybe I could change the refer= ence to
[RFC3986] section 2.2? If you think it would be better, should I write= it out
more like this?
In the extreme, only the scheme is needed. "dav:" is an example. But
without a colon, it's not a scheme.

path =3D / path-noscheme ; begins with a non-colon segment
/ path-rootless ; begins with a segment
/ path-empty ; zero characters

path-noscheme =3D segment-nz-nc *( "/" segment )
path-rootless =3D segment-nz *( "/" segment )
path-empty =3D 0<pchar>

segment =3D *pchar
segment-nz =3D 1*pchar
segment-nz-nc =3D 1*( unreserved / pct-encoded / sub-delims / "@" )
; non-zero-length segment without any colon ":"

pchar =3D unreserved / pct-encoded / sub-delims / ":" / "@"
I'm not sure what these parts of the grammar are supposed to do here,
but you can't just start in the middle of the grammar and claim that yo= u
get an URI.


Hi Martin,
I know at first glance it might look out of place but the #fg34htx par= t isn't a
fragment.
By the definitions of RFC 3986, it is a fragment (identifier). This is
independent of what you want to call it.

I think the "drop" part will be recognized as the scheme name because
of its dereferencing.
Please do the following, as an easy experiment:

- Create a simple Web page somewhere, e.g. called base.html,
and in it, include the following part:
<a href=3D'drop#fg34htx'>Link to drop URI</a>
- In the same directory, create another Web page, with the file name
simply being 'drop' (without extension). Way down in that Web page,
include the following:
<a id=3D'#fg34htx' name=3D'#fg34htx'>Fragment fg34htx</a>
- Activate the link in the first page, and observe how it goes to the
fragment in the second page.
[If you set up the pages on the server, you may have to take some care
that the 'drop' file is really served with an HTML media type; this may
be a bit tricky.]

If my explanations don't help, maybe doing this experiment will show yo= u
what I mean.

Regards, Martin.

P.S.: The solution is simple. If you change "drop#fg34htx" to
"drop:fg34htx", then you actually match the URI production and no longe= r
have a fragment id.

>> On May 19, 2020 at 5:40 AM "Henry S. Thompson" <=20 ht@inf.ed.ac.uk
>> <mailto:=20 ht@inf.ed.ac.uk>> wrote:
>>
>>
>> Timothy Mcsweeney writes:
>>
>>> This is a request for a review of the 'drop' URI scheme. T= he
>>> draft can be found here
>> Without commenting on any other aspect of the proposed scheme,= and
>> mostly just to save people time, I found the following aspect = of the
>> proposal somewhat misleading:
>>
>> "Similar to the previously registered 'tel' [RFC3966] and
>> 'leaptofrogans' [RFC8589] URIs, the 'drop' URI scheme is
>> syntactically correct but does not need to use all 5 of the
>> parse-able components available to it. The 'drop' scheme uses = the
>> number sign '#' as a general delimiter as seen in Appendix
>> A. Collected ABNF [RFC3986]. The scheme syntax is as follows:
>>
>> " drop-uri =3D 'drop#' character string
>>
>> drop # fg34htx
>> \__/ \_/ \_____/
>> | | |
>> <scheme> | <scheme-specific-part>
>> <gen-delim>
>> "
>>
>> I read this as implying that
>>
>> 1) 'tel' and 'leaptofrogans' URIs did not begin "tel:" and
>> "leaptofrogans:";
>> 2) The 3986 ABNF for URIs recognises "drop#fg34htx" as a URI.
>>
>> Neither of these is in fact that case. The two referenced sche= mes
>> require ':' after the 'scheme' component, and the 'URI' produc= tion does
>> _not_ recognise the above example. (The 'URI-reference' produc= tion does,
>> but not using the 'scheme' production to cover the "drop" part= .)
>>
>> ht
>> --
>> Henry S. Thompson, School of Informatics, University of Edinbu= rgh
>> 10 Crichton Street, Edinburgh EH8 9AB, SCOTLAND -- (44) 131 65= 0-4440
>> Fax: (44) 131 650-4587, e-mail:=20 ht@inf.ed.ac.uk <mailto:=20 ht@inf.ed.ac.uk>
>> [mail from me _always_ has a .sig like this -- mail without it= is forged spam]
>>
>> The University of Edinburgh is a charitable body, registered i= n
>> Scotland, with registration number SC005336.
>>
>> _______________________________________________
>> Uri-review mailing list

_______________________________________________
Uri-review mailing list

--
Prof. Dr.sc. Martin J. D=C3=BCrst
Department of Intelligent Information Technology
College of Science and Engineering
Aoyama Gakuin University
Fuchinobe 5-1-10, Chuo-ku, Sagamihara
252-5258 Japan
=20 From nobody Wed May 20 20:36:06 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 770B13A0A68 for ; Wed, 20 May 2020 20:36:04 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.897 X-Spam-Level: X-Spam-Status: No, score=-1.897 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, SPF_HELO_NONE=0.001, SPF_NONE=0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id 9XYj5f6d-d30 for ; Wed, 20 May 2020 20:36:02 -0700 (PDT) Received: from pdx1-sub0-mail-fallback-a1.dreamhost.com (pdx1-sub0-mail-fallback-a1.dreamhost.com [64.90.62.138]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id DCB4C3A0A43 for ; Wed, 20 May 2020 20:36:02 -0700 (PDT) Received: from pdx1-sub0-mail-a35.g.dreamhost.com (unknown [10.35.42.197]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by pdx1-sub0-mail-fallback-a1.dreamhost.com (Postfix) with ESMTPS id 520F027791C; Wed, 20 May 2020 20:36:01 -0700 (PDT) Received: from pdx1-sub0-mail-a35.g.dreamhost.com (localhost [127.0.0.1]) by pdx1-sub0-mail-a35.g.dreamhost.com (Postfix) with ESMTP id 7B5FE7E0BE; Wed, 20 May 2020 20:34:02 -0700 (PDT) Received: from [10.0.0.2] (c-73-245-214-115.hsd1.fl.comcast.net [73.245.214.115]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) (Authenticated sender: mail@dan.tobias.name) by pdx1-sub0-mail-a35.g.dreamhost.com (Postfix) with ESMTPSA id 9E0A67F673; Wed, 20 May 2020 20:34:01 -0700 (PDT) X-DH-BACKEND: pdx1-sub0-mail-a35 From: "Daniel R. Tobias" To: Timothy Mcsweeney Date: Wed, 20 May 2020 23:34:01 -0400 MIME-Version: 1.0 CC: uri-review@ietf.org Message-ID: <5EC5F6A9.7599.23B3E5E7@dan.tobias.name> Priority: normal In-reply-to: <122709156.27676.1590010716156@email.ionos.com> References: <491516506.246380.1589851279474@email.ionos.com>, , <122709156.27676.1590010716156@email.ionos.com> X-mailer: Pegasus Mail for Windows (4.73.639) Content-type: text/plain; charset=ISO-8859-1 Content-transfer-encoding: Quoted-printable Content-description: Mail message body X-VR-OUT-STATUS: OK X-VR-OUT-SCORE: 0 X-VR-OUT-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeduhedruddutddgjedtucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuggftfghnshhusghstghrihgsvgdpffftgfetoffjqffuvfenuceurghilhhouhhtmecufedttdenucenucfjughrpefhvfffggfukfgjfhfotgfgsehtsfertdfftddunecuhfhrohhmpedfffgrnhhivghlucftrdcuvfhosghirghsfdcuoegurghnsehtohgsihgrshdrnhgrmhgvqeenucggtffrrghtthgvrhhnpeeilefhheejteeifffgvedutdekjeegtdetffeuhffffeffleehvdehudffhfdvkeenucffohhmrghinhepshhouhhpshguvghlihdrtghomhdpuggrnhdrihhnfhhonecukfhppeejfedrvdeghedrvddugedrudduheenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepmhhouggvpehsmhhtphdphhgvlhhopegluddtrddtrddtrddvngdpihhnvghtpeejfedrvdeghedrvddugedrudduhedprhgvthhurhhnqdhprghthhepfdffrghnihgvlhcutfdrucfvohgsihgrshdfuceouggrnhesthhosghirghsrdhnrghmvgeqpdhmrghilhhfrhhomhepuggrnhesthhosghirghsrdhnrghmvgdpnhhrtghpthhtohepuhhrihdqrhgvvhhivgifsehivghtfhdrohhrgh Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 21 May 2020 03:36:05 -0000 On 20 May 2020 at 17:38, Timothy Mcsweeney wrote: > I followed your instructions and I could not recreate what you wanted > me to see. Here are the two pages I made: > > > > > Perhaps it had something to do with the hosting provider??=A0 I'm not > sure what's wrong here.=A0=A0 This is the content of your first page: test link As you can see, the "href" value doesn't have "drop#fg34htx" by itself as requested; it has a "http://" before it. This transforms it into a http URI with "drop" as its domain, which my browser "helpfully" converts into a link to drop.com. It would presumably then go to the fragment #fg34htx in that page if such a fragment existed. -- =3D=3D Dan =3D=3D Dan's Mail Format Site: http://mailformat.dan.info/ Dan's Web Tips: http://webtips.dan.info/ Dan's Domain Site: http://domains.dan.info/ From nobody Wed May 20 21:08:58 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 6CE113A0AA8 for ; Wed, 20 May 2020 21:08:57 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.798 X-Spam-Level: X-Spam-Status: No, score=-1.798 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, HTML_MESSAGE=0.001, MIME_HTML_ONLY=0.1, RCVD_IN_MSPIKE_H2=-0.001, SPF_NONE=0.001, URIBL_BLOCKED=0.001] autolearn=no autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id BS1XfjtDGkAd for ; Wed, 20 May 2020 21:08:55 -0700 (PDT) Received: from mout.perfora.net (mout.perfora.net [74.208.4.196]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id A3D1A3A0AA6 for ; Wed, 20 May 2020 21:08:55 -0700 (PDT) Received: from oxusgaltgw04.schlund.de ([10.72.72.50]) by mrelay.perfora.net (mreueus003 [74.208.5.2]) with ESMTPSA (Nemesis) id 0MHIph-1jp2eL3p6B-00E7IO for ; Thu, 21 May 2020 06:08:54 +0200 Date: Thu, 21 May 2020 00:08:54 -0400 (EDT) From: Timothy Mcsweeney Reply-To: Timothy Mcsweeney To: uri-review@ietf.org Message-ID: <1888561123.43509.1590034134659@email.ionos.com> In-Reply-To: <5EC5F6A9.7599.23B3E5E7@dan.tobias.name> References: <491516506.246380.1589851279474@email.ionos.com>, , <122709156.27676.1590010716156@email.ionos.com> <5EC5F6A9.7599.23B3E5E7@dan.tobias.name> MIME-Version: 1.0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: 7bit X-Priority: 3 Importance: Normal X-Mailer: Open-Xchange Mailer v7.10.1-Rev31 X-Originating-Client: open-xchange-appsuite X-Provags-ID: V03:K1:FMKiz6raTd78ja9FpASNUq6EIGQWlifcb/WVYmjv1U4mooQpNev 8hZT33oiht+7BIDh8HMrVviOYFs2I3gO44n7xge9XPbtuOjKjtDJ09y0wmitGjbTbZU7O2H Mj2ssMv4nvP4vQjv3X1pPrS0kY/Ltwxt5WJ71Ar3fw+9rbbXJlyUwWMxxPjAenMq+uwJWnF gShZIx50a5PwoMbRTkd9Q== X-UI-Out-Filterresults: notjunk:1;V03:K0:QkZpf8zgUuQ=:AO/CkLxbJusFVoBLZGcraZ kUkiB37jXsJmbJQjKTittmTt88VY/DXOylTgZgfLHkcN33vLoEbUu2XDmmrLctYLVMIZGV4ro 7mhyuKHz2naxfeM2LOv0QwZHfR4uGTyGjX8DhfI7DiKt6roQaAsidZcfwTnWZsmzMtVyz0lTJ NpYg7bwvJzvEyq5FYtBYGGGmuamPgrzJ14PRvxId+ogwOJJpCPp0xH1VlYLnN9pQLxADnqy4/ UFj2BqUN1RKJO4lLDRlaz+blay3AW8jdQxrfawXCP/y48E2DNkVdqaiztGEO6sJsG3m9+Erss SecHYQHDO4B1eLCGe13FHpugUj/RZo2DMu1AwUzpJYchr17rm6qY22bGsWhe2euee78IkZQHT 5qFZsl8R5QCUikqDkvhDOcuvRsGTWNNU/mp9nagTimL2qnJfEOMJskj6pLHtyJHePqOso3WwA aYnAuITK2YyZmXBzAQjFQaWLpLtnzYsdND3aTaeF+sFH5E0xbOpgZPoGY2DITPmr2sN7zzqi/ BpvDMRelSi/Gt3ApzrWKYcydVAnMYKccU6vV41an3h3ZSpSLnUC+u8Jafjl72SkvKhvnEYhB9 MoAxpJAdpHErwuZXzkmiCg/QUN/JYXIMmV8mQYLkwYWUGCwnDAtJhua1SEkDQia7uyu++Sx5s V4KcPJH52rkqmorUi1kJUH3h5SrIrbXOQJ3SXoowltI+Rg8DZGfjG5fFhB89jdZxEU7rs7Cgi PERS8qWeQheJ70aER/1x9SEjPp+dneswu/RRjTDoyqfbLswwjyuWROFUH6aNy8nga1FjyUEC/ 59wcVAxWHDKcQsU21jJuZaoSPSgQG3xSuaqw7ZcY1GUD372hEQjzO8QGGHMsmx1cpvFDr4i Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 21 May 2020 04:08:58 -0000
hmm, it looks like my email client made it into a link.  I fixed it and it works perfectly!  Thank you Daniel.
On May 20, 2020 at 11:34 PM "Daniel R. Tobias" < dan@tobias.name> wrote:


On 20 May 2020 at 17:38, Timothy Mcsweeney wrote:

I followed your instructions and I could not recreate what you wanted
me to see. Here are the two pages I made:
Perhaps it had something to do with the hosting provider??  I'm not
sure what's wrong here.  
This is the content of your first page:

<!doctype html>
<html>
<head><meta charset="us-ascii">
<title>test link</title>

</head>
<body>
<div> <h2><a href=' http://drop#fg34htx' target="_blank"
rel="noopener">Link to drop URI</a></div>
</body>
</html>


As you can see, the "href" value doesn't have "drop#fg34htx" by
itself as requested; it has a " http://" before it. This transforms it
into a http URI with "drop" as its domain, which my browser
"helpfully" converts into a link to drop.com. It would presumably
then go to the fragment #fg34htx in that page if such a fragment
existed.

--
== Dan ==
Dan's Mail Format Site: http://mailformat.dan.info/
Dan's Web Tips: http://webtips.dan.info/
Dan's Domain Site: http://domains.dan.info/

From nobody Fri May 22 14:29:35 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id D44AB3A0CD7 for ; Fri, 22 May 2020 14:29:33 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -0.774 X-Spam-Level: X-Spam-Status: No, score=-0.774 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, HTML_MESSAGE=0.001, MIME_HTML_ONLY=0.1, MISSING_HEADERS=1.021, RCVD_IN_MSPIKE_H3=0.001, RCVD_IN_MSPIKE_WL=0.001, SPF_NONE=0.001, URIBL_BLOCKED=0.001] autolearn=no autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id JECZbkNJ9fjr for ; Fri, 22 May 2020 14:29:32 -0700 (PDT) Received: from mout.perfora.net (mout.perfora.net [74.208.4.194]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 2258F3A0C9C for ; Fri, 22 May 2020 14:29:32 -0700 (PDT) Received: from oxusgaltgw04.schlund.de ([10.72.72.50]) by mrelay.perfora.net (mreueus003 [74.208.5.2]) with ESMTPSA (Nemesis) id 0Ld00U-1jC1DV0oK0-00iCzZ for ; Fri, 22 May 2020 23:29:29 +0200 Date: Fri, 22 May 2020 17:29:28 -0400 (EDT) From: Timothy Mcsweeney Reply-To: Timothy Mcsweeney Cc: uri-review@ietf.org Message-ID: <624184630.116213.1590182968873@email.ionos.com> In-Reply-To: <5EC5F6A9.7599.23B3E5E7@dan.tobias.name> References: <491516506.246380.1589851279474@email.ionos.com>, , <122709156.27676.1590010716156@email.ionos.com> <5EC5F6A9.7599.23B3E5E7@dan.tobias.name> MIME-Version: 1.0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: 7bit X-Priority: 3 Importance: Normal X-Mailer: Open-Xchange Mailer v7.10.1-Rev31 X-Originating-Client: open-xchange-appsuite X-Provags-ID: V03:K1:1/jlfhUBPvzS5/BuFN0XyQYKt4zJYFM/iSsd9Sj86rO/Qbg4Yk5 Tn4wJZ8TV9MjXL5cMrJiM2iGmWF8z1+GMfNqmJaR/tPNSUYCUTQIab186+ipYMwDISBjxPe FKjhnJ7uIiK7i8Cpc0h7LxLTpYiFHCZwOvNNUYHIWzTh+Si8Pb/b/cuzMEPhZTNdxugyBOY ci1I5e6pISU0sp3xP7Q6Q== X-UI-Out-Filterresults: notjunk:1;V03:K0:NxWmwrvLYgY=:QFbc//H+Upo5aABDTQClUP Z1KyeRlFzU6yjw09lbZS9MUvoVSBHu2Zoi8WINbHZBssjj1e66VGPAaW9dSDoT0RfmNtCrdZ7 cT9Dk8TbkmdNmsPLUutXebaWZzB3RL6AH+2A2fLCUKUX4EMcOShq4w9acaHhfISVSoEkeXYu7 97wQmZjW1uIUn6zTLbiANiWmvX/VWnIH8UeQ1FebnS6HpWX+6GuZ+Z+Cp/qBYI27LnG1BJnNE RNLun3HIXXi60+XOGG8OzOqwHO0x0Cd2ORuJ2PfrvgYosj2xCmKRKxFVTEeSq5yHZFOoJewi4 DQFDvIPFSCqZ8aKqhLFmW4Xa8RFHpv93x8nBP4nCgU4kAlxAq3soOKugULkCa/vwec8IPVg5f yFbdMSa2a+QLikcZyi+slDNu7AXZvZPR1e5FxXGfCnwXpNbiiGWblwqWZpG3qIHXspQH4KxV1 DXpQCwfVBAPxfs+oMB1Tw904NORiM05elinWgAagDEZM1VbZxaMh0mBvVQ3L8kuhgbX/5K/hE 6AhCJYtRnSknE8Wt0XCdXwEFFBSbb+aVoUD9lzRke6d66gmPMM2pFoQtJk1kOyOG6xZaH00Dd Uvd4ydAYZKfztnV7QFR7V1oDw13v962B6LNSjUKweG2Pn3xzOhBcb1mZsmus/uf7gMdrAacJo 6+F3CGdtZWuggPPOf/lGJaCUyVuv222HwDnUi6A+4WSmyCI5g2p4CBpwynzL4KrCU/jDWxVkp /GfdS30msx5KiXxrq8KRv7jVpjnc6mBy5WXpBnf5vhS+ChbxHJ3FPZhngU/QR3ybPJsKzF3/s IMGRTdyG9mBmty/4eIw3nFI6BPgpVnvwfvYmcLCP7U1PsKHf9CG2zxE5e1oh/omFYHXL/xt Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 22 May 2020 21:29:34 -0000
Hello everyone, 

The second draft of the 'drop' URI scheme is available and can be found here <  https://datatracker.ietf.org/doc/draft-mcsweeney-drop-scheme/>.  Thank you. 

Sincerely, 
Tim McSweeney
On May 20, 2020 at 11:34 PM "Daniel R. Tobias" < dan@tobias.name> wrote:


On 20 May 2020 at 17:38, Timothy Mcsweeney wrote:

I followed your instructions and I could not recreate what you wanted
me to see. Here are the two pages I made:
Perhaps it had something to do with the hosting provider??  I'm not
sure what's wrong here.  
This is the content of your first page:

<!doctype html>
<html>
<head><meta charset="us-ascii">
<title>test link</title>

</head>
<body>
<div> <h2><a href=' http://drop#fg34htx' target="_blank"
rel="noopener">Link to drop URI</a></div>
</body>
</html>


As you can see, the "href" value doesn't have "drop#fg34htx" by
itself as requested; it has a " http://" before it. This transforms it
into a http URI with "drop" as its domain, which my browser
"helpfully" converts into a link to drop.com. It would presumably
then go to the fragment #fg34htx in that page if such a fragment
existed.

--
== Dan ==
Dan's Mail Format Site: http://mailformat.dan.info/
Dan's Web Tips: http://webtips.dan.info/
Dan's Domain Site: http://domains.dan.info/

From nobody Sat May 23 16:31:42 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 4BABB3A0F57 for ; Sat, 23 May 2020 16:31:41 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.898 X-Spam-Level: X-Spam-Status: No, score=-1.898 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_MSPIKE_H2=-0.001, SPF_HELO_NONE=0.001, SPF_NONE=0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id J242wER9a-Zt for ; Sat, 23 May 2020 16:31:39 -0700 (PDT) Received: from cheetah.birch.relay.mailchannels.net (cheetah.birch.relay.mailchannels.net [23.83.209.34]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 9B2B43A0F58 for ; Sat, 23 May 2020 16:31:39 -0700 (PDT) X-Sender-Id: dreamhost|x-authsender|mail@dan.tobias.name Received: from relay.mailchannels.net (localhost [127.0.0.1]) by relay.mailchannels.net (Postfix) with ESMTP id 2C135640D2E for ; Sat, 23 May 2020 23:31:38 +0000 (UTC) Received: from pdx1-sub0-mail-a47.g.dreamhost.com (100-96-14-14.trex.outbound.svc.cluster.local [100.96.14.14]) (Authenticated sender: dreamhost) by relay.mailchannels.net (Postfix) with ESMTPA id B4AD3640BE7 for ; Sat, 23 May 2020 23:31:37 +0000 (UTC) X-Sender-Id: dreamhost|x-authsender|mail@dan.tobias.name Received: from pdx1-sub0-mail-a47.g.dreamhost.com (pop.dreamhost.com [64.90.62.162]) (using TLSv1.2 with cipher DHE-RSA-AES256-GCM-SHA384) by 0.0.0.0:2500 (trex/5.18.8); Sat, 23 May 2020 23:31:38 +0000 X-MC-Relay: Neutral X-MailChannels-SenderId: dreamhost|x-authsender|mail@dan.tobias.name X-MailChannels-Auth-Id: dreamhost X-Turn-Army: 0cb7bb856cd6db28_1590276697980_21279769 X-MC-Loop-Signature: 1590276697980:1881812034 X-MC-Ingress-Time: 1590276697980 Received: from pdx1-sub0-mail-a47.g.dreamhost.com (localhost [127.0.0.1]) by pdx1-sub0-mail-a47.g.dreamhost.com (Postfix) with ESMTP id 63C8E990A6 for ; Sat, 23 May 2020 16:31:37 -0700 (PDT) Received: from [10.0.0.2] (c-73-245-214-115.hsd1.fl.comcast.net [73.245.214.115]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) (Authenticated sender: mail@dan.tobias.name) by pdx1-sub0-mail-a47.g.dreamhost.com (Postfix) with ESMTPSA id A52B19B24B for ; Sat, 23 May 2020 16:31:36 -0700 (PDT) X-DH-BACKEND: pdx1-sub0-mail-a47 From: "Daniel R. Tobias" To: uri-review@ietf.org Date: Sat, 23 May 2020 19:31:35 -0400 MIME-Version: 1.0 Message-ID: <5EC9B257.31362.CC5E003@dan.tobias.name> Priority: normal In-reply-to: <624184630.116213.1590182968873@email.ionos.com> References: <491516506.246380.1589851279474@email.ionos.com>, <5EC5F6A9.7599.23B3E5E7@dan.tobias.name>, <624184630.116213.1590182968873@email.ionos.com> X-mailer: Pegasus Mail for Windows (4.73.639) Content-type: text/plain; charset=ISO-8859-1 Content-transfer-encoding: Quoted-printable Content-description: Mail message body X-VR-OUT-STATUS: OK X-VR-OUT-SCORE: 0 X-VR-OUT-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeduhedrudduiedgvdefucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuggftfghnshhusghstghrihgsvgdpffftgfetoffjqffuvfenuceurghilhhouhhtmecufedttdenucenucfjughrpefhvfffggfukfgjfhfotgfgsehtsfertdfftddunecuhfhrohhmpedfffgrnhhivghlucftrdcuvfhosghirghsfdcuoegurghnsehtohgsihgrshdrnhgrmhgvqeenucggtffrrghtthgvrhhnpedufeejveetvdehheehleelffevveehjedtueejleelgeefjefgudetgfethfffgfenucffohhmrghinhepihgvthhfrdhorhhgpdgurghnrdhinhhfohenucfkphepjeefrddvgeehrddvudegrdduudehnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmohguvgepshhmthhppdhhvghloheplgdutddrtddrtddrvdgnpdhinhgvthepjeefrddvgeehrddvudegrdduudehpdhrvghtuhhrnhdqphgrthhhpedfffgrnhhivghlucftrdcuvfhosghirghsfdcuoegurghnsehtohgsihgrshdrnhgrmhgvqedpmhgrihhlfhhrohhmpegurghnsehtohgsihgrshdrnhgrmhgvpdhnrhgtphhtthhopehurhhiqdhrvghvihgvfiesihgvthhfrdhorhhg Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 23 May 2020 23:31:42 -0000 On 22 May 2020 at 17:29, Timothy Mcsweeney wrote: > The second draft of the 'drop' URI scheme is available and can be > found here <=A0 > https://datatracker.ietf.org/doc/draft-mcsweeney-drop-scheme/>.=A0 Thank > you.=A0 This doesn't seem to resolve any of the issues people have raised; it still omits the mandatory colon after the scheme, and puts its main content, used for resource resolution and retrieval, in a fragment identifier, which is intended for client-specific post-processing after a document is retrieved. -- =3D=3D Dan =3D=3D Dan's Mail Format Site: http://mailformat.dan.info/ Dan's Web Tips: http://webtips.dan.info/ Dan's Domain Site: http://domains.dan.info/ From nobody Sat May 23 20:37:47 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id D1CF63A107B for ; Sat, 23 May 2020 20:37:45 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.798 X-Spam-Level: X-Spam-Status: No, score=-1.798 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, HTML_MESSAGE=0.001, MIME_HTML_ONLY=0.1, RCVD_IN_MSPIKE_H2=-0.001, SPF_NONE=0.001, URIBL_BLOCKED=0.001] autolearn=no autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id 6W5eROxLmr1N for ; Sat, 23 May 2020 20:37:44 -0700 (PDT) Received: from mout.perfora.net (mout.perfora.net [74.208.4.196]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 4DB003A1020 for ; Sat, 23 May 2020 20:37:44 -0700 (PDT) Received: from oxusgaltgw00.schlund.de ([10.72.72.46]) by mrelay.perfora.net (mreueus003 [74.208.5.2]) with ESMTPSA (Nemesis) id 0M2bMR-1imWH426FR-00sLed for ; Sun, 24 May 2020 05:37:43 +0200 Date: Sat, 23 May 2020 23:37:42 -0400 (EDT) From: Timothy Mcsweeney Reply-To: Timothy Mcsweeney To: uri-review@ietf.org Message-ID: <811217250.273727.1590291463007@email.ionos.com> In-Reply-To: <5EC9B257.31362.CC5E003@dan.tobias.name> References: <491516506.246380.1589851279474@email.ionos.com>, <5EC5F6A9.7599.23B3E5E7@dan.tobias.name>, <624184630.116213.1590182968873@email.ionos.com> <5EC9B257.31362.CC5E003@dan.tobias.name> MIME-Version: 1.0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: 7bit X-Priority: 3 Importance: Normal X-Mailer: Open-Xchange Mailer v7.10.1-Rev31 X-Originating-Client: open-xchange-appsuite X-Provags-ID: V03:K1:1h4+KrDfzoUZOzsV+Ekoy/SiOmaDQUHvQezB0hb/sXCB58sYyAA vDbQopgPU48F5OPXrBIAqmI3Tfl43M4CgYq8LKR719YAod5Xottwf5HRmBM7nKlGJerLBmP CXc256Elg9poYsj8xHtfHd+e2ms9Pla12r2TSRNqynYVPV8xHxBZXrKlk4AedMA75H4j5y5 bKgarpgtH16q8Ytcds5ew== X-UI-Out-Filterresults: notjunk:1;V03:K0:JDfrFKDe9jI=:r08o96P410FOOQvA7nw/o9 gEMHsUycX9Z9UiPSLxhgdOaNSKauGLQRnAeCQvLmulhw59f7oBU+D9YVTGtTO4AJWqe4a5sMf aoSD9TVdC3J8oXGlLASE5TUq0hvCm09TGNXTNIJd8+zxKVg3so59c56GMmJ2egHDXRwCdu25H +qKrs5QRHVyyPDY7oEf5bGRpSK4btBgvPA+A3Hb2ZjMe9J3B09RJzs7slmePc5vZFakSekesj NkwwXxTGj362jyrCTgfUuT8X1WHxPuBYN/hQLR+2yd34o0Xbv9iMBMw/Hm704Rj7QrPdny4iM +iAjwuM7i3NneZZEmIpjyv1xajied9X8bOBO0WaPQfNPO7fgodT9kV2uJSpZHHOco5zytfXvL mJjXNcAbr5ftMPjpOEedeHFBsnhr16l4OlowNN8wqbb2uc77zRWO5WbwUZAuXHj1ml1WVuTUr Xe96NbeVeqmoLL+6yzOt85jsJATgIMeBRXEPwgNXc0t4J2vXXT9bK1LTqD1jwKFH+H4VGkro1 lkvUGvWI+t5zaBJM7VTuCSS8axik0T7o/HrW8zcrFxbkh7qU4GsINkiQ4ys24wekAmuacDd+7 JbCV0PmgUf8v7cmXuF798FNIVP60Le3+JJLkJ8vGP2rhOpVKfcyVWV5uR+ge8rGnggHeJjEQR enZV/FXsqwMVgG3R7fuEu06sLj/TccJS6J5kBilumoYRlqctr3kcN4xvauF1wIZYneFEnGp6L 4d4v91Q+fIbBhmfUOLMRcoFEs7w/fhdZRwUWeBQUq823R9vQQz1hYIzgsM6iJ+yPQr6T4Tq5x WEz4Cdbl14e/upjZaBNqVjhOzmnBQmV+ZUy/BWT5L99CBRmsPmoRqjvwZGJUb2S7t3roQwz Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 May 2020 03:37:46 -0000
Hi Daniel, 

I think I know what you're saying but I want to make sure so, when you say 'mandatory colon' do you mean for all URIs or for just http?

Tim
On May 23, 2020 at 7:31 PM "Daniel R. Tobias" < dan@tobias.name> wrote:


On 22 May 2020 at 17:29, Timothy Mcsweeney wrote:

The second draft of the 'drop' URI scheme is available and can be
found here < 
you. 
This doesn't seem to resolve any of the issues people have raised; it
still omits the mandatory colon after the scheme, and puts its main
content, used for resource resolution and retrieval, in a fragment
identifier, which is intended for client-specific post-processing
after a document is retrieved.

--
== Dan ==
Dan's Mail Format Site: http://mailformat.dan.info/
Dan's Web Tips: http://webtips.dan.info/
Dan's Domain Site: http://domains.dan.info/


_______________________________________________
Uri-review mailing list
From nobody Sun May 24 05:31:56 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 30CED3A0B01 for ; Sun, 24 May 2020 05:31:55 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.795 X-Spam-Level: X-Spam-Status: No, score=-1.795 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, HTML_MESSAGE=0.001, MIME_HTML_ONLY=0.1, RCVD_IN_MSPIKE_H3=0.001, RCVD_IN_MSPIKE_WL=0.001, SPF_NONE=0.001, URIBL_BLOCKED=0.001] autolearn=no autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id v8Es11nTMeMx for ; Sun, 24 May 2020 05:31:53 -0700 (PDT) Received: from mout.perfora.net (mout.perfora.net [74.208.4.194]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id B18ED3A0B00 for ; Sun, 24 May 2020 05:31:53 -0700 (PDT) Received: from oxusgaltgw07.schlund.de ([10.72.72.53]) by mrelay.perfora.net (mreueus002 [74.208.5.2]) with ESMTPSA (Nemesis) id 0LptxZ-1j91Pe1lOJ-00ffns for ; Sun, 24 May 2020 14:31:49 +0200 Date: Sun, 24 May 2020 08:31:48 -0400 (EDT) From: Timothy Mcsweeney Reply-To: Timothy Mcsweeney To: uri-review@ietf.org Message-ID: <1783049000.100771.1590323508943@email.ionos.com> In-Reply-To: <5EC9B257.31362.CC5E003@dan.tobias.name> References: <491516506.246380.1589851279474@email.ionos.com>, <5EC5F6A9.7599.23B3E5E7@dan.tobias.name>, <624184630.116213.1590182968873@email.ionos.com> <5EC9B257.31362.CC5E003@dan.tobias.name> MIME-Version: 1.0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: 7bit X-Priority: 3 Importance: Normal X-Mailer: Open-Xchange Mailer v7.10.1-Rev31 X-Originating-Client: open-xchange-appsuite X-Provags-ID: V03:K1:idWu/1eiy2Blm1D73oWCua3RS0dtij2gS1HikNULOAy0IV4OseD cBB84MKD6NBgM0ORz/icc30GuF38f7KwMMocRyXks/AytuCiyAkyVX2ZMzUglFyCnQ61CAM CKul5DRNUXyY4G0USJtCVt2t2zbNpepeHI+TefrQ+qvH1pgFFn2+z6sNT8+au3fVIBEH3ef sfBO0jhgoAnVvdMuy/+Og== X-UI-Out-Filterresults: notjunk:1;V03:K0:C6hfErWU+Qs=:TjSvU1/dnHaSfXo3RjZfi3 /b1WnnpPEDH3sVqEp6bWkrqMbkOcSKlgbtrUho//A9tIML4Pb8KaZwj35y6wHsosmMC7qCcDo LNQBWZxT5qMM/YNKd1CMAji8x1aIWRUzJ9g3EA46W4gVP7ZCsaNLMVq+Pne7lMniUBNrKwEQ6 SZFFLnsWEntObvN7fFAHt5E4g5tRPgayGpdHanda5xqBkikiGaAVayZN4B4slZctgM4H9MLFw gYLbjwq8TlQM4QuCVfmVp9ax78uwnx8dPMVwTUAxQlq96y3GsgbuK2CXwo9BZOVh6cb5ZBiCi k1+o/SNS2DGjIGtzU+qQMlTj24LuF4O9DgKR3lnzg2RXtfqoxEhLTGwO0SCj8/LhdG2c1ba6u FZj7Y14BKFAwj6U3RK80HjuUA/a+3TxaiTgZAjJXIo3mHIQ7/g0UwzHpCfKCFnLVHXYMz1wh4 bXgx4iBcx2JGxvceMBvdxwYTZw+6Bj8Cie2GMYcFGR/Ba3ts0SMXJ7VPaoD2tHZwagUTl0X2n FUhVOhJL16tfafW0htilchmLAkE1jOrN50jzewN8ROixp390ur3bEOXY/MMLdGbwICYqYlAWQ Xt8wWU6KaS9CapnRRTaN7AbnBxJy66bYbcp4RrT1Ufh3sde24vY3uPcThnV79R4QJggG6akKC ROGXKI4OjF3+E2aaetOsytV55eeDScUedMcKk1EkuM5YmypeYRwLS7Mv54XCpL+JF/oIiyru3 EGvuYRFnAE7YASn9sfWVBxz6DokpXwyyc/XT4cWqrQWK7jSDkSH95IoF4xxHvMGzscNE4omyw p/ohSq03fahmkZyJvNre0mCZqPbTXjXLmVvwUNUta7pPmBqZxyPIdlwujcqSs8cKy92TANx Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 May 2020 12:31:55 -0000
Hi Dan, 

For the browser example, it is going to leave the client as 'drop#fg234' but come back to the client as 'fg234.dropexample.com'. 

Looking at the second sentence of section 2.2 of rfc3986 it give three choices for defining delimiters:
by using general syntax
by each scheme-specific syntax
by the implementation-specific syntax of a URI's derefrencing algorithm.

The 'drop' scheme uses the last one.  I was thinking of a way to show this being done with http but didn't thing anyone really wanted to see that.

Tim

On May 23, 2020 at 7:31 PM "Daniel R. Tobias" < dan@tobias.name> wrote:


On 22 May 2020 at 17:29, Timothy Mcsweeney wrote:

The second draft of the 'drop' URI scheme is available and can be
found here < 
you. 
This doesn't seem to resolve any of the issues people have raised; it
still omits the mandatory colon after the scheme, and puts its main
content, used for resource resolution and retrieval, in a fragment
identifier, which is intended for client-specific post-processing
after a document is retrieved.

--
== Dan ==
Dan's Mail Format Site: http://mailformat.dan.info/
Dan's Web Tips: http://webtips.dan.info/
Dan's Domain Site: http://domains.dan.info/


_______________________________________________
Uri-review mailing list
From nobody Sun May 24 07:53:26 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id B89593A0A47 for ; Sun, 24 May 2020 07:53:24 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.897 X-Spam-Level: X-Spam-Status: No, score=-1.897 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, SPF_HELO_NONE=0.001, SPF_NONE=0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id kbpjvwQGH60L for ; Sun, 24 May 2020 07:53:23 -0700 (PDT) Received: from dog.birch.relay.mailchannels.net (dog.birch.relay.mailchannels.net [23.83.209.48]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 063F93A0A44 for ; Sun, 24 May 2020 07:53:22 -0700 (PDT) X-Sender-Id: dreamhost|x-authsender|mail@dan.tobias.name Received: from relay.mailchannels.net (localhost [127.0.0.1]) by relay.mailchannels.net (Postfix) with ESMTP id 0541F480558 for ; Sun, 24 May 2020 14:53:22 +0000 (UTC) Received: from pdx1-sub0-mail-a47.g.dreamhost.com (100-96-14-14.trex.outbound.svc.cluster.local [100.96.14.14]) (Authenticated sender: dreamhost) by relay.mailchannels.net (Postfix) with ESMTPA id 9A5E0481026 for ; Sun, 24 May 2020 14:53:21 +0000 (UTC) X-Sender-Id: dreamhost|x-authsender|mail@dan.tobias.name Received: from pdx1-sub0-mail-a47.g.dreamhost.com (pop.dreamhost.com [64.90.62.162]) (using TLSv1.2 with cipher DHE-RSA-AES256-GCM-SHA384) by 0.0.0.0:2500 (trex/5.18.8); Sun, 24 May 2020 14:53:21 +0000 X-MC-Relay: Neutral X-MailChannels-SenderId: dreamhost|x-authsender|mail@dan.tobias.name X-MailChannels-Auth-Id: dreamhost X-Thoughtful-Trouble: 69d778df3ea04132_1590332001844_1098406238 X-MC-Loop-Signature: 1590332001844:865731969 X-MC-Ingress-Time: 1590332001844 Received: from pdx1-sub0-mail-a47.g.dreamhost.com (localhost [127.0.0.1]) by pdx1-sub0-mail-a47.g.dreamhost.com (Postfix) with ESMTP id 5E61B97D71 for ; Sun, 24 May 2020 07:53:21 -0700 (PDT) Received: from [10.0.0.2] (c-73-245-214-115.hsd1.fl.comcast.net [73.245.214.115]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) (Authenticated sender: mail@dan.tobias.name) by pdx1-sub0-mail-a47.g.dreamhost.com (Postfix) with ESMTPSA id D28B697D6C for ; Sun, 24 May 2020 07:53:19 -0700 (PDT) X-DH-BACKEND: pdx1-sub0-mail-a47 From: "Daniel R. Tobias" To: uri-review@ietf.org Date: Sun, 24 May 2020 10:53:19 -0400 MIME-Version: 1.0 Message-ID: <5ECA8A5F.4144.1011C4A2@dan.tobias.name> Priority: normal In-reply-to: <811217250.273727.1590291463007@email.ionos.com> References: <491516506.246380.1589851279474@email.ionos.com>, <5EC9B257.31362.CC5E003@dan.tobias.name>, <811217250.273727.1590291463007@email.ionos.com> X-mailer: Pegasus Mail for Windows (4.73.639) Content-type: text/plain; charset=US-ASCII Content-transfer-encoding: 7BIT Content-description: Mail message body X-VR-OUT-STATUS: OK X-VR-OUT-SCORE: 0 X-VR-OUT-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeduhedruddukedgkedtucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuggftfghnshhusghstghrihgsvgdpffftgfetoffjqffuvfenuceurghilhhouhhtmecufedttdenucenucfjughrpefhvfffggfukfgjfhfotgfgsehtufertdfftddvnecuhfhrohhmpedfffgrnhhivghlucftrdcuvfhosghirghsfdcuoegurghnsehtohgsihgrshdrnhgrmhgvqeenucggtffrrghtthgvrhhnpeetkefhhfeuveetffdtueeghedtveejfffhgeehuedtieevveefudelledvhefgjeenucffohhmrghinhepuggrnhdrihhnfhhonecukfhppeejfedrvdeghedrvddugedrudduheenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepmhhouggvpehsmhhtphdphhgvlhhopegluddtrddtrddtrddvngdpihhnvghtpeejfedrvdeghedrvddugedrudduhedprhgvthhurhhnqdhprghthhepfdffrghnihgvlhcutfdrucfvohgsihgrshdfuceouggrnhesthhosghirghsrdhnrghmvgeqpdhmrghilhhfrhhomhepuggrnhesthhosghirghsrdhnrghmvgdpnhhrtghpthhtohepuhhrihdqrhgvvhhivgifsehivghtfhdrohhrgh Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 May 2020 14:53:25 -0000 On 23 May 2020 at 23:37, Timothy Mcsweeney wrote: > I think I know what you're saying but I want to make sure so, when you > say 'mandatory colon' do you mean for all URIs or for just http? As far as I'm aware, and has come up in this discussion earlier, the colon is required for all URIs, not specific to http. -- == Dan == Dan's Mail Format Site: http://mailformat.dan.info/ Dan's Web Tips: http://webtips.dan.info/ Dan's Domain Site: http://domains.dan.info/ From nobody Sun May 24 07:54:19 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 590993A0A4D for ; Sun, 24 May 2020 07:54:17 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.896 X-Spam-Level: X-Spam-Status: No, score=-1.896 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_DNSWL_BLOCKED=0.001, SPF_HELO_NONE=0.001, SPF_NONE=0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id uvqdJNFnj1By for ; Sun, 24 May 2020 07:54:16 -0700 (PDT) Received: from dog.birch.relay.mailchannels.net (dog.birch.relay.mailchannels.net [23.83.209.48]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 12B1A3A0A43 for ; Sun, 24 May 2020 07:54:15 -0700 (PDT) X-Sender-Id: dreamhost|x-authsender|mail@dan.tobias.name Received: from relay.mailchannels.net (localhost [127.0.0.1]) by relay.mailchannels.net (Postfix) with ESMTP id 492E8700BFA for ; Sun, 24 May 2020 14:54:15 +0000 (UTC) Received: from pdx1-sub0-mail-a47.g.dreamhost.com (100-96-14-14.trex.outbound.svc.cluster.local [100.96.14.14]) (Authenticated sender: dreamhost) by relay.mailchannels.net (Postfix) with ESMTPA id CCB50701123 for ; Sun, 24 May 2020 14:54:14 +0000 (UTC) X-Sender-Id: dreamhost|x-authsender|mail@dan.tobias.name Received: from pdx1-sub0-mail-a47.g.dreamhost.com (pop.dreamhost.com [64.90.62.162]) (using TLSv1.2 with cipher DHE-RSA-AES256-GCM-SHA384) by 0.0.0.0:2500 (trex/5.18.8); Sun, 24 May 2020 14:54:15 +0000 X-MC-Relay: Neutral X-MailChannels-SenderId: dreamhost|x-authsender|mail@dan.tobias.name X-MailChannels-Auth-Id: dreamhost X-Cold-Abortive: 6428084e7d25e6f1_1590332055075_1503620646 X-MC-Loop-Signature: 1590332055075:418730023 X-MC-Ingress-Time: 1590332055074 Received: from pdx1-sub0-mail-a47.g.dreamhost.com (localhost [127.0.0.1]) by pdx1-sub0-mail-a47.g.dreamhost.com (Postfix) with ESMTP id EEBFA97D75 for ; Sun, 24 May 2020 07:54:13 -0700 (PDT) Received: from [10.0.0.2] (c-73-245-214-115.hsd1.fl.comcast.net [73.245.214.115]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) (Authenticated sender: mail@dan.tobias.name) by pdx1-sub0-mail-a47.g.dreamhost.com (Postfix) with ESMTPSA id 7448597D71 for ; Sun, 24 May 2020 07:54:12 -0700 (PDT) X-DH-BACKEND: pdx1-sub0-mail-a47 From: "Daniel R. Tobias" To: uri-review@ietf.org Date: Sun, 24 May 2020 10:54:12 -0400 MIME-Version: 1.0 Message-ID: <5ECA8A94.23977.101292FE@dan.tobias.name> Priority: normal In-reply-to: <1783049000.100771.1590323508943@email.ionos.com> References: <491516506.246380.1589851279474@email.ionos.com>, <5EC9B257.31362.CC5E003@dan.tobias.name>, <1783049000.100771.1590323508943@email.ionos.com> X-mailer: Pegasus Mail for Windows (4.73.639) Content-type: text/plain; charset=ISO-8859-1 Content-transfer-encoding: Quoted-printable Content-description: Mail message body X-VR-OUT-STATUS: OK X-VR-OUT-SCORE: 0 X-VR-OUT-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeduhedruddukedgkedtucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuggftfghnshhusghstghrihgsvgdpffftgfetoffjqffuvfenuceurghilhhouhhtmecufedttdenucenucfjughrpefhvfffggfukfgjfhfotgfgsehtsfertdfftddunecuhfhrohhmpedfffgrnhhivghlucftrdcuvfhosghirghsfdcuoegurghnsehtohgsihgrshdrnhgrmhgvqeenucggtffrrghtthgvrhhnpeeffeeludehtedvleehgeeikedvtedtfffgieeuvdduteetvdegkedufefhueefgeenucffohhmrghinheptghomhdrrghspdgurghnrdhinhhfohenucfkphepjeefrddvgeehrddvudegrdduudehnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmohguvgepshhmthhppdhhvghloheplgdutddrtddrtddrvdgnpdhinhgvthepjeefrddvgeehrddvudegrdduudehpdhrvghtuhhrnhdqphgrthhhpedfffgrnhhivghlucftrdcuvfhosghirghsfdcuoegurghnsehtohgsihgrshdrnhgrmhgvqedpmhgrihhlfhhrohhmpegurghnsehtohgsihgrshdrnhgrmhgvpdhnrhgtphhtthhopehurhhiqdhrvghvihgvfiesihgvthhfrdhorhhg Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 May 2020 14:54:17 -0000 On 24 May 2020 at 8:31, Timothy Mcsweeney wrote: > For the browser example, it is going to leave the client as > 'drop#fg234' but come back to the client as 'fg234.dropexample.com'.=A0 As I understand it, fragment identifiers don't leave the client, but are used when processing the returned data from the server at the client side. -- =3D=3D Dan =3D=3D Dan's Mail Format Site: http://mailformat.dan.info/ Dan's Web Tips: http://webtips.dan.info/ Dan's Domain Site: http://domains.dan.info/ From nobody Sun May 24 08:53:10 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 4F4273A0AE5 for ; Sun, 24 May 2020 08:53:08 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.795 X-Spam-Level: X-Spam-Status: No, score=-1.795 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, HTML_MESSAGE=0.001, MIME_HTML_ONLY=0.1, RCVD_IN_MSPIKE_H3=0.001, RCVD_IN_MSPIKE_WL=0.001, SPF_NONE=0.001, URIBL_BLOCKED=0.001] autolearn=no autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id Efa95infOa9V for ; Sun, 24 May 2020 08:53:06 -0700 (PDT) Received: from mout.perfora.net (mout.perfora.net [74.208.4.197]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 9E35B3A0AE2 for ; Sun, 24 May 2020 08:53:06 -0700 (PDT) Received: from oxusgaltgw03.schlund.de ([10.72.72.49]) by mrelay.perfora.net (mreueus003 [74.208.5.2]) with ESMTPSA (Nemesis) id 0MQy1w-1jSXJX3xAk-00UGES for ; Sun, 24 May 2020 17:53:05 +0200 Date: Sun, 24 May 2020 11:53:05 -0400 (EDT) From: Timothy Mcsweeney Reply-To: Timothy Mcsweeney To: uri-review@ietf.org Message-ID: <1426881880.158099.1590335585858@email.ionos.com> In-Reply-To: <5ECA8A94.23977.101292FE@dan.tobias.name> References: <491516506.246380.1589851279474@email.ionos.com>, <5EC9B257.31362.CC5E003@dan.tobias.name>, <1783049000.100771.1590323508943@email.ionos.com> <5ECA8A94.23977.101292FE@dan.tobias.name> MIME-Version: 1.0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: 7bit X-Priority: 3 Importance: Normal X-Originating-Client: open-xchange-appsuite X-Mailer: Open-Xchange Mailer v7.10.1-Rev31 X-Provags-ID: V03:K1:tk2HsWA4HqqhIpq+rpPZhndkIOPIuzXaStJbx8PHliJBBU/6Yg9 BgLQf2lj+Cy9gPIp8BCTOXOt1NKLfDTFtAF68b255vpGF2pYsnInICb8K97UcCNjcAC7UeT ppdF2GH9uWoWOknRvSoYIWWVXdGxMV+YMS/laHPUpPWB0PkbouG5rLObEkqvYmQT0ql5QdP D82mu5JQKPm+FuWASUCyQ== X-UI-Out-Filterresults: notjunk:1;V03:K0:Pns1s/QSCs8=:kXFQtSJEfMTwoz0VypsHEL l4BhgCNcMgT68H/E8EOl7UNWfN/otHkxP/5aC8CqpYApjBCU1/j1gZMjbI53vNrqTNqpbwj1T IQYKnEo8lBmfJDSwHxe7hrKDiZoXwcDdZMn/XBO+LSzaAtbXnu244/2fS/XyTtYv2XRArKsP7 TPp5VXXo6OpUdd63UPjRPcBVZEDEjRN00j7iOvO18EfT8QhBHXHOSwrGLZRV8buPlHa5++IFP ur2KMm43qJqDIF5Yf/b0mQIBxykaTJpkeFyZJdaQhXClyVo9a+95xHR8d545GBSNVAOpA/KFg sTXzsLIRi5hU//xNndOlS1bCd23QinDY+DwY5RQjNwV8bGFsAm4ZzIPh4bubQZCFWHHHEcgae EZp60v/6+DTJlptUKMhTcFlD+5o1WnejiwfIgqaK+9rqqioFTxyrBfwkfUOWtYF8r7XDbz6L9 Yw0A8bQbrYqSHxaYL5ukCaU+RhUaaT/Xo+ICFZ5sL1l1VY0B+636Org1LeHQU8p+b9U9NbkIB wq2GNmJUtA39p/o5D/P57F32WgU/+DB6FGxOofYILmQutwxz5Q9/osVDxJrvObZU0JNXa0Mv8 hsjaVA4Cyafj9EnoNhyTgRpd2XtTt6ilchIytZ+ujYKWMkd6fprui1e4cg8dojFxjkmGWF4iR jGbefZ0a42KWGRSlCWcHY23Q/ZtJxzRdEoQiHg2zj792iu3CiOONZB5mnqgy0drirlCLXa8LJ Mh1pPRxdoZiDjVG93BeMARJWSydjhHMMUcyugN9YVT7gBWD4myUzCsyJ6mu+uwhtNwxxjii3h 21FBnE4h+KvU01upOnb45MjvGwtnq5lpcYwj5RTeeng+QxCm0ZvdqslPvKtmq5veyVWEsEq Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 May 2020 15:53:08 -0000
Hi Dan,

Yes, I agree and understand that the same way as you.   But when the "#" leaves the client it is not leaving as a fragment, it is leaving as a way to separate the URI components, <scheme> and <path> or for http it would be separating <scheme> and <authority>.  It is this that makes me believe that even if the colon is required for http resolution, it is not necessarily required for all URI.

Tim  


On May 24, 2020 at 10:54 AM "Daniel R. Tobias" < dan@tobias.name> wrote:


On 24 May 2020 at 8:31, Timothy Mcsweeney wrote:

For the browser example, it is going to leave the client as
'drop#fg234' but come back to the client as 'fg234.dropexample.com'. 
As I understand it, fragment identifiers don't leave the client, but
are used when processing the returned data from the server at the
client side.

--
== Dan ==
Dan's Mail Format Site: http://mailformat.dan.info/
Dan's Web Tips: http://webtips.dan.info/
Dan's Domain Site: http://domains.dan.info/


_______________________________________________
Uri-review mailing list
From nobody Sun May 24 09:02:12 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id F0B693A0AF9 for ; Sun, 24 May 2020 09:02:10 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -0.499 X-Spam-Level: X-Spam-Status: No, score=-0.499 tagged_above=-999 required=5 tests=[BAYES_05=-0.5, SPF_HELO_NONE=0.001, SPF_PASS=-0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id Gsix22agFZyi for ; Sun, 24 May 2020 09:02:08 -0700 (PDT) Received: from postoffice.gristmillmedia.com (dret.net [209.188.86.86]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id B8D423A0AF7 for ; Sun, 24 May 2020 09:02:08 -0700 (PDT) Received: from 123.234.197.178.dynamic.wless.lssmb00p-cgnat.res.cust.swisscom.ch ([178.197.234.123]:12279 helo=[172.20.10.7]) by postoffice.gristmillmedia.com with esmtpsa (TLS1.2) tls TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256 (Exim 4.93) (envelope-from ) id 1jct4f-0006CF-V7; Sun, 24 May 2020 12:02:06 -0400 To: Timothy Mcsweeney , uri-review@ietf.org References: <491516506.246380.1589851279474@email.ionos.com> <5EC9B257.31362.CC5E003@dan.tobias.name> <1783049000.100771.1590323508943@email.ionos.com> <5ECA8A94.23977.101292FE@dan.tobias.name> <1426881880.158099.1590335585858@email.ionos.com> From: Erik Wilde Message-ID: <94368b41-c15b-da2c-421d-fdd9300be6e9@dret.net> Date: Sun, 24 May 2020 18:02:03 +0200 User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.15; rv:68.0) Gecko/20100101 Thunderbird/68.8.0 MIME-Version: 1.0 In-Reply-To: <1426881880.158099.1590335585858@email.ionos.com> Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 8bit X-AntiAbuse: This header was added to track abuse, please include it with any abuse report X-AntiAbuse: Primary Hostname - postoffice.gristmillmedia.com X-AntiAbuse: Original Domain - ietf.org X-AntiAbuse: Originator/Caller UID/GID - [47 12] / [47 12] X-AntiAbuse: Sender Address Domain - dret.net X-Get-Message-Sender-Via: postoffice.gristmillmedia.com: authenticated_id: birdhouse@dret.net X-Authenticated-Sender: postoffice.gristmillmedia.com: birdhouse@dret.net X-Source: X-Source-Args: X-Source-Dir: Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 May 2020 16:02:11 -0000 hey tim. On 2020-05-24 17:53, Timothy Mcsweeney wrote: > Yes, I agree and understand that the same way as you.   But when the "#" > leaves the client it is not leaving as a fragment, what people are telling you is that "#" and anything following it never leaves the client, by definition. > it is leaving as a > way to separate the URI components, and or for http it > would be separating and .  It is this that makes me > believe that even if the colon is required for http resolution, it is > not necessarily required for all URI. this discussion could be more productive if you had a brief look at the specs you're depending on. the very first rule shown in https://tools.ietf.org/html/rfc3986#section-3 is URI = scheme ":" hier-part [ "?" query ] [ "#" fragment ] each URI is defined like this and must have a colon. cheers, dret. -- erik wilde | mailto:erik.wilde@dret.net | | http://dret.net/netdret | | http://twitter.com/dret | From nobody Sun May 24 11:26:33 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 0E9143A0C7D for ; Sun, 24 May 2020 11:26:31 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.795 X-Spam-Level: X-Spam-Status: No, score=-1.795 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, HTML_MESSAGE=0.001, MIME_HTML_ONLY=0.1, RCVD_IN_MSPIKE_H3=0.001, RCVD_IN_MSPIKE_WL=0.001, SPF_NONE=0.001, URIBL_BLOCKED=0.001] autolearn=no autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id l2tUwCSK0doF for ; Sun, 24 May 2020 11:26:28 -0700 (PDT) Received: from mout.perfora.net (mout.perfora.net [74.208.4.197]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id CDCA13A0C7B for ; Sun, 24 May 2020 11:26:27 -0700 (PDT) Received: from oxusgaltgw03.schlund.de ([10.72.72.49]) by mrelay.perfora.net (mreueus002 [74.208.5.2]) with ESMTPSA (Nemesis) id 0MA82J-1jjkvo0mtN-00BKRj; Sun, 24 May 2020 20:25:45 +0200 Date: Sun, 24 May 2020 14:25:45 -0400 (EDT) From: Timothy Mcsweeney Reply-To: Timothy Mcsweeney To: Erik Wilde , uri-review@ietf.org Message-ID: <1310141163.159340.1590344745080@email.ionos.com> In-Reply-To: <94368b41-c15b-da2c-421d-fdd9300be6e9@dret.net> References: <491516506.246380.1589851279474@email.ionos.com> <5EC9B257.31362.CC5E003@dan.tobias.name> <1783049000.100771.1590323508943@email.ionos.com> <5ECA8A94.23977.101292FE@dan.tobias.name> <1426881880.158099.1590335585858@email.ionos.com> <94368b41-c15b-da2c-421d-fdd9300be6e9@dret.net> MIME-Version: 1.0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: 7bit X-Priority: 3 Importance: Normal X-Mailer: Open-Xchange Mailer v7.10.1-Rev31 X-Originating-Client: open-xchange-appsuite X-Provags-ID: V03:K1:XIwPqh+pheZ2ne74zY+VB9/o+bbVud+5t2RxebxxrhhY6IGqdE1 6deDl3Gnj3Lskh4GDyl5fhe3gGNBkw4KW9BlDJJMepyyYqdR6/CG86/d0UJtZ1KPDheIQXb n1CbPFf8qXdxLADR1biwSy1OV6BeIAATvSPWt1ief2Mmo7VSpWsfbbz0fQdteSzOc3uck2q RWbW2dKn1uioO7ge0Wv6Q== X-UI-Out-Filterresults: notjunk:1;V03:K0:D4pFJ5L7g+k=:tTBMnfKHWix+8KJUsDj/V7 /RtALAmk3F+lttT0o1eeRrOUwOmzjxDcZRQTwnqhduaTOsz3mNnoCFc71g1g3ZrfYrw2jxttj Fz15mk2uPYtXpr5H8aP8R4hAAk+YYHLHNP5ps/Ra76KA69IP4oaBrYSKVmWh59NbvtWawOsam FAqQF+YfmW5gu6FaoNUkrihFvxyX0eYdXN6Pxyic0ruaBIhH3HT75OmW3MpcCXEaSmMI7HPwx m+hwF1t10wkO2irUd8ZkeLbqhuqhCI6NhB6dzKMoSPkLhHbRF0NpskPt8vgeOEf8F9o0fJ3HH SXqzzK0WB+5lp1sIOysBX7T4VtpCI0vEygw3yXknFqsuDm8avtCGnQmfKLuEUssyp2/4lVKqp TLxpLMAn0N1xIqG8ovRsvmMWTAYIT5xuIFyL+/nzjAQU6ipqyBOh2BUPzVySbGrj3iUvtdFRA D9twjgatrwZ6/Hc8QbC7t7E6KosWuB5F3QlZJPVOvAaxAbm1ucwgsc3tiA9vUyHByrSRrghrn I4WiTDCUczzRg7x3jD78VlsetVbWI/e3Ed/ii4A0XnaUv2inn1PovC5eFiU84doDyYgjHKFQF RFalMQcL29ppHRcQsP2UV6iNxD++avjQRMCuci32ROWnJKuLlpr0FJCHmNoBPFry8PlOtmNLa 6pRQYaHElviS7LnC32s54oYAdpvfUudn7ULh5/i2ZarvKRLh/+bfu3SvEJTagoAlyP8Lo75v3 HEv8HqBHMcBkrau+e9In2XgjR1KyaJgrchQZjr5CS0HfzQjXZsapHgnJ3SfE9p0uvrLOLBfSU fEsJyJAXf52krqipaIvlEq4kySypnUhPtbmIL6QbLl1qtw602t515Sd2RU8MtKEvIKaHDN2 Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 May 2020 18:26:31 -0000
Hi Erik, 

Thank you, I will have another look at my reference to section 3.   
Would you agree that in "https://ietf.org" the colon is not part of the hier-part? 
On May 24, 2020 at 12:02 PM Erik Wilde < erik.wilde@dret.net> wrote:


hey tim.

On 2020-05-24 17:53, Timothy Mcsweeney wrote:
Yes, I agree and understand that the same way as you.   But when the "#"
leaves the client it is not leaving as a fragment,
what people are telling you is that "#" and anything following it never
leaves the client, by definition.

it is leaving as a
way to separate the URI components, <scheme> and <path> or for http it
would be separating <scheme> and <authority>.  It is this that makes me
believe that even if the colon is required for http resolution, it is
not necessarily required for all URI.
this discussion could be more productive if you had a brief look at the
specs you're depending on. the very first rule shown in

URI = scheme ":" hier-part [ "?" query ] [ "#" fragment ]

each URI is defined like this and must have a colon.

cheers,

dret.

--
erik wilde | mailto: erik.wilde@dret.net |
From nobody Sun May 24 15:08:55 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 182463A0D7B for ; Sun, 24 May 2020 15:08:51 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -2.001 X-Spam-Level: X-Spam-Status: No, score=-2.001 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, DKIMWL_WL_HIGH=-0.001, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, DKIM_VALID_EF=-0.1, HTML_MESSAGE=0.001, HTTPS_HTTP_MISMATCH=0.1, RCVD_IN_MSPIKE_H2=-0.001, SPF_PASS=-0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no Authentication-Results: ietfa.amsl.com (amavisd-new); dkim=pass (1024-bit key) header.d=microsoft.com Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id k84WBj9_aAYC for ; Sun, 24 May 2020 15:08:49 -0700 (PDT) Received: from NAM11-DM6-obe.outbound.protection.outlook.com (mail-dm6nam11on2091.outbound.protection.outlook.com [40.107.223.91]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id D9CB13A0D78 for ; Sun, 24 May 2020 15:08:48 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=fqRETu/k4FLC4GI71wiRsDAIuv6SacuvxxFlVdlWL0ZyOu+nGTmnyhMsq4lOqAndtw8jAbMGghPtsPaKwlC6rIR4NVWbWC+vy2qhw7F1NounSlH1ftOrmewdIZU7h+Nx6ORwiklFZICybpjViqES/bTx5IX9LrlZ5gHMJ1TZ6c8w3W6Tx7B8HW+1idrXmNunD+OByZfUHuCAAiSYVGOu8AO0+jakNWp420q9RMbwwHZnFDTuCn/yNz3OEe0CslWnhLallLxPqNuJ8q2VVvsjpK39m6iI0QfiPtIWtqtmoACFn1cb2inUfSoW+sxPC2Kkq+CsicN0V0eTD2fmH0S3JA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=3zzRDH+vuNDVH2plGouAXroe+4g5dvx1QqBmVb6wdwQ=; b=LqQzy/Z+vMxGLxwH5Ho514S8+7rZzm5w920PB2YsGvyuGRQCjjsa29PdByvyI7aF0Mh+SswrW2vL1jCXoEf+egh/fd0tLPjEOF7TXlp8dUnUvnfSnCvfLt4nZmHeJssK8DXruXtL7cVMK5ftmGcMvr9c5ShwJYA2Y2z9L87/Hy/WZbwFxgOdOcQ3zlydCHrnLPbpqr6fZMSRKB99nTJaXqRd8y48vjlLEOXJ3lqqS83ai4+YNIfUHfV20iJyfDMG12eSuNRpEA6wdMqnawnp0qAV3owuFihaatvEVuZC9ZqNwDvf64e4h64aUm0/FzT51DxPd2hzfHn6tcWicXMjYg== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=pass smtp.mailfrom=microsoft.com; dmarc=pass action=none header.from=microsoft.com; dkim=pass header.d=microsoft.com; arc=none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=selector2; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=3zzRDH+vuNDVH2plGouAXroe+4g5dvx1QqBmVb6wdwQ=; b=Q/zBJ33z32Xvzz0VYzR9TKJ1AXOodv8N6XDib4CDyJcycZEqjnqDK139l89/Oe3lhlK4p40Q2cDEbII0dFioZRnbBJcxq8cMkQGB2PFdb4uAvyzxQ4VVPBxhWZsfEwJpU4Cpfsoi63+EOofVhganYEbkEX0djvOp5bZtpmDh4p0= Received: from BL0PR2101MB1027.namprd21.prod.outlook.com (2603:10b6:207:30::33) by BL0PR2101MB1315.namprd21.prod.outlook.com (2603:10b6:208:92::9) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.3066.3; Sun, 24 May 2020 22:08:46 +0000 Received: from BL0PR2101MB1027.namprd21.prod.outlook.com ([fe80::29cb:295d:97bc:3f7f]) by BL0PR2101MB1027.namprd21.prod.outlook.com ([fe80::29cb:295d:97bc:3f7f%9]) with mapi id 15.20.3045.005; Sun, 24 May 2020 22:08:46 +0000 From: Dave Thaler To: Timothy Mcsweeney , Erik Wilde , "uri-review@ietf.org" Thread-Topic: [Uri-review] Request for review Thread-Index: AQHWLXv2FOLhs6xYVEiA5gx7JqVPaaivKCm+gABmVgCAAPVnAIAA/yoAgABjToCAAr7PAIABtHOAgADZ/gCAACfJAIAAEHOAgAACgoCAACgmgIAAPVtg Date: Sun, 24 May 2020 22:08:46 +0000 Message-ID: References: <491516506.246380.1589851279474@email.ionos.com> <5EC9B257.31362.CC5E003@dan.tobias.name> <1783049000.100771.1590323508943@email.ionos.com> <5ECA8A94.23977.101292FE@dan.tobias.name> <1426881880.158099.1590335585858@email.ionos.com> <94368b41-c15b-da2c-421d-fdd9300be6e9@dret.net> <1310141163.159340.1590344745080@email.ionos.com> In-Reply-To: <1310141163.159340.1590344745080@email.ionos.com> Accept-Language: en-US Content-Language: en-US X-MS-Has-Attach: X-MS-TNEF-Correlator: msip_labels: MSIP_Label_f42aa342-8706-4288-bd11-ebb85995028c_Enabled=true; MSIP_Label_f42aa342-8706-4288-bd11-ebb85995028c_SetDate=2020-05-24T22:08:45Z; MSIP_Label_f42aa342-8706-4288-bd11-ebb85995028c_Method=Standard; MSIP_Label_f42aa342-8706-4288-bd11-ebb85995028c_Name=Internal; MSIP_Label_f42aa342-8706-4288-bd11-ebb85995028c_SiteId=72f988bf-86f1-41af-91ab-2d7cd011db47; MSIP_Label_f42aa342-8706-4288-bd11-ebb85995028c_ActionId=054ed3d0-3f5f-49df-ac81-956c72dc4f72; MSIP_Label_f42aa342-8706-4288-bd11-ebb85995028c_ContentBits=0 authentication-results: dropnumber.com; dkim=none (message not signed) header.d=none;dropnumber.com; dmarc=none action=none header.from=microsoft.com; x-originating-ip: [2601:600:9780:16f0:9119:ff0b:566e:fe9] x-ms-publictraffictype: Email x-ms-office365-filtering-ht: Tenant x-ms-office365-filtering-correlation-id: adad7d9a-bd21-435a-6a83-08d8002f07cf x-ms-traffictypediagnostic: BL0PR2101MB1315: x-microsoft-antispam-prvs: x-ms-oob-tlc-oobclassifiers: OLM:6790; x-forefront-prvs: 0413C9F1ED x-ms-exchange-senderadcheck: 1 x-microsoft-antispam: BCL:0; x-microsoft-antispam-message-info: UAUUaRo3aEibbH5M4kdFNEz+52dEhgsuGEP5yCUr5CaS7HJ4jknp7tTmPEDFNKoIIZ9IcHwFAbwq4MA4bwUcLzGK81BBWbFFxKf0EjchBTQEdO8SOyHvoHjBlUaPepVnIWFEY4uBKn/mI0AtQDf7yWbjn5+4Ks+owsP6vzBSI227FJuw8Mjms/IVakYiJxoOx6ZAerA3Mfx6VqQPnYNxK2Bw9wN68vCWfYJFKcMr+8yLP1u798m4rwfxo/SZ7CjtG36F++bMQB8v48qme6VO4pVwuLZzkvWgMepCm/5b2n56YYx4X+bG20dMh/EzeiakCrWWBN0z4ikzvyAkQNCqbl2q+yr2r72CZ2HgpadVivTrEqmpA9y5hU/AeQ6CfV5BOxFGdQt8Jmsi3t6A/yz86A== x-forefront-antispam-report: CIP:255.255.255.255; CTRY:; LANG:en; SCL:1; SRV:; IPV:NLI; SFV:NSPM; H:BL0PR2101MB1027.namprd21.prod.outlook.com; PTR:; CAT:NONE; SFTY:; SFS:(4636009)(136003)(366004)(376002)(346002)(396003)(39860400002)(82960400001)(82950400001)(478600001)(10290500003)(966005)(8990500004)(166002)(9686003)(8676002)(2906002)(55016002)(8936002)(33656002)(5660300002)(86362001)(64756008)(110136005)(66446008)(52536014)(186003)(71200400001)(66556008)(66476007)(6506007)(7696005)(9326002)(66946007)(76116006)(53546011)(316002); DIR:OUT; SFP:1102; x-ms-exchange-antispam-messagedata: bcFEMdpIXF0Ugwc3DcsKfRhs6Y284k55+YKFbvxBz9kT4wTMzZuJ3Z8fIrHrI6rGr5jWO6U4Xcmda2pVn1V9EVn7EjCVvyymSlFl8KMRQ1b0f6HUrKIjau8NjAhUJhF6YgxhXCP3mxkZmRDhCQUUtsKobC7Hjng9XmntfLnj9w0jiJYdpmu+wseUROxYwpZj96Xb4EegHHrNDUBwePF8mcuBvHbGJA7CfNXaN6Yf9TVBV9d/EhiD2oGv9o6GAOg7/sw1murDhtCq2N22GJ6lv+0uMCqySbf4j7c1BLvjjHeYaVGy2D4tCG5hjqax56DENAoKRrZujZSk563slzW3suAjS8KIAyvDKknfYNRQt243ncPIpetHB1UvccnSZKyiFduDHtAbWq7WDytBQhZF38HaX7N4k6cM34gogYFHEMnEWraWpE6yxuMmvjZhzs+i/aRxWVnQz5GuW7C3qRKe9Oy6njIqa1cN6PGgOKfruo+90RO1IPubNUHWTyRuC+Uue3xcGUzw3UGLlJilqHF8Rui/jdh+iS2VVR9xBy/Esj8= x-ms-exchange-transport-forked: True Content-Type: multipart/alternative; boundary="_000_BL0PR2101MB102738EF50D7C8AD647E10BBA3B20BL0PR2101MB1027_" MIME-Version: 1.0 X-OriginatorOrg: microsoft.com X-MS-Exchange-CrossTenant-Network-Message-Id: adad7d9a-bd21-435a-6a83-08d8002f07cf X-MS-Exchange-CrossTenant-originalarrivaltime: 24 May 2020 22:08:46.6302 (UTC) X-MS-Exchange-CrossTenant-fromentityheader: Hosted X-MS-Exchange-CrossTenant-id: 72f988bf-86f1-41af-91ab-2d7cd011db47 X-MS-Exchange-CrossTenant-mailboxtype: HOSTED X-MS-Exchange-CrossTenant-userprincipalname: vA8ZLy/eEV4k6WSr8vfys/OfG83H9/BUEFVNDs/JHKKwyx8z8AjA1v04mUn0aerL7rzsXCrwSOb4R/Tzkc3qGviCQUPMwez4am7JkJtuVxI= X-MS-Exchange-Transport-CrossTenantHeadersStamped: BL0PR2101MB1315 Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 May 2020 22:08:53 -0000 --_000_BL0PR2101MB102738EF50D7C8AD647E10BBA3B20BL0PR2101MB1027_ Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: base64 SGkgVGltLA0KDQpDb3JyZWN0IHRoZSBjb2xvbiBpcyBub3QgcGFydCBvZiB0aGUgaGllci1wYXJ0 LCB0aGUgaGllci1wYXJ0IGlzIHdoYXQgY29tZXMgYWZ0ZXIgdGhlIGNvbG9uLiAgUkZDIDM5ODYg c2F5czoNCg0KVVJJICAgICAgICAgPSBzY2hlbWUgIjoiIGhpZXItcGFydCBbICI/IiBxdWVyeSBd IFsgIiMiIGZyYWdtZW50IF0NCg0KT25seSBzdHJpbmdzIHRoYXQgY29uZm9ybSB0byB0aGUgYWJv dmUgYXJlIFVSSXMuDQpTbyDigJxkcm9wI3NkNTRnNTTigJ0gaXMgbm90IGEgVVJJIGJlY2F1c2Ug aXQgZG9lcyBub3QgY29uZm9ybSB0byB0aGUgYWJvdmUgc3ludGF4LCBhcyBpdCBoYXMgbm8g4oCc OuKAnQ0KDQrigJxkcm9wOnNkNTRnNTTigJ0gb24gdGhlIG90aGVyIGhhbmQgd291bGQgYmUgYSB2 YWxpZCBVUkkuDQoNClRoaXMgaXMgd2hhdCBmb2xrcyBhcmUgc2F5aW5nIHdoZW4gdGhleSBzYXkg aWYgeW91IGp1c3QgY2hhbmdlIHRoZSDigJwj4oCdIHRvIGEg4oCcOuKAnSBpbiB5b3VyIGRyYWZ0 IHRoZW4gaXQgYmVjb21lcyBsZWdhbC4NCg0KRGF2ZQ0KDQpGcm9tOiBVcmktcmV2aWV3IDx1cmkt cmV2aWV3LWJvdW5jZXNAaWV0Zi5vcmc+IE9uIEJlaGFsZiBPZiBUaW1vdGh5IE1jc3dlZW5leQ0K U2VudDogU3VuZGF5LCBNYXkgMjQsIDIwMjAgMTE6MjYgQU0NClRvOiBFcmlrIFdpbGRlIDxlcmlr LndpbGRlQGRyZXQubmV0PjsgdXJpLXJldmlld0BpZXRmLm9yZw0KU3ViamVjdDogUmU6IFtVcmkt cmV2aWV3XSBSZXF1ZXN0IGZvciByZXZpZXcNCg0KSGkgRXJpaywNCg0KVGhhbmsgeW91LCBJIHdp bGwgaGF2ZSBhbm90aGVyIGxvb2sgYXQgbXkgcmVmZXJlbmNlIHRvIHNlY3Rpb24gMy4NCldvdWxk IHlvdSBhZ3JlZSB0aGF0IGluICJodHRwczovL2lldGYub3JnIiB0aGUgY29sb24gaXMgbm90IHBh cnQgb2YgdGhlIGhpZXItcGFydD8NCk9uIE1heSAyNCwgMjAyMCBhdCAxMjowMiBQTSBFcmlrIFdp bGRlIDwgZXJpay53aWxkZUBkcmV0Lm5ldDxtYWlsdG86ZXJpay53aWxkZUBkcmV0Lm5ldD4+IHdy b3RlOg0KDQoNCmhleSB0aW0uDQoNCk9uIDIwMjAtMDUtMjQgMTc6NTMsIFRpbW90aHkgTWNzd2Vl bmV5IHdyb3RlOg0KWWVzLCBJIGFncmVlIGFuZCB1bmRlcnN0YW5kIHRoYXQgdGhlIHNhbWUgd2F5 IGFzIHlvdS4gICBCdXQgd2hlbiB0aGUgIiMiDQpsZWF2ZXMgdGhlIGNsaWVudCBpdCBpcyBub3Qg bGVhdmluZyBhcyBhIGZyYWdtZW50LA0Kd2hhdCBwZW9wbGUgYXJlIHRlbGxpbmcgeW91IGlzIHRo YXQgIiMiIGFuZCBhbnl0aGluZyBmb2xsb3dpbmcgaXQgbmV2ZXINCmxlYXZlcyB0aGUgY2xpZW50 LCBieSBkZWZpbml0aW9uLg0KDQppdCBpcyBsZWF2aW5nIGFzIGENCndheSB0byBzZXBhcmF0ZSB0 aGUgVVJJIGNvbXBvbmVudHMsIDxzY2hlbWU+IGFuZCA8cGF0aD4gb3IgZm9yIGh0dHAgaXQNCndv dWxkIGJlIHNlcGFyYXRpbmcgPHNjaGVtZT4gYW5kIDxhdXRob3JpdHk+LiAgSXQgaXMgdGhpcyB0 aGF0IG1ha2VzIG1lDQpiZWxpZXZlIHRoYXQgZXZlbiBpZiB0aGUgY29sb24gaXMgcmVxdWlyZWQg Zm9yIGh0dHAgcmVzb2x1dGlvbiwgaXQgaXMNCm5vdCBuZWNlc3NhcmlseSByZXF1aXJlZCBmb3Ig YWxsIFVSSS4NCnRoaXMgZGlzY3Vzc2lvbiBjb3VsZCBiZSBtb3JlIHByb2R1Y3RpdmUgaWYgeW91 IGhhZCBhIGJyaWVmIGxvb2sgYXQgdGhlDQpzcGVjcyB5b3UncmUgZGVwZW5kaW5nIG9uLiB0aGUg dmVyeSBmaXJzdCBydWxlIHNob3duIGluDQpodHRwczovL3Rvb2xzLmlldGYub3JnL2h0bWwvcmZj Mzk4NiNzZWN0aW9uLTM8aHR0cHM6Ly9uYW0wNi5zYWZlbGlua3MucHJvdGVjdGlvbi5vdXRsb29r LmNvbS8/dXJsPWh0dHBzJTNBJTJGJTJGdG9vbHMuaWV0Zi5vcmclMkZodG1sJTJGcmZjMzk4NiUy M3NlY3Rpb24tMyZkYXRhPTAyJTdDMDElN0NkdGhhbGVyJTQwbWljcm9zb2Z0LmNvbSU3QzMwMTg0 NWI3OWYzNDQxN2I4ZGExMDhkODAwMGZmZTZjJTdDNzJmOTg4YmY4NmYxNDFhZjkxYWIyZDdjZDAx MWRiNDclN0MxJTdDMCU3QzYzNzI1OTQxNTk4ODUyMzQyNSZzZGF0YT04U2RGUElRUG1mUE9lZkVZ ZyUyRnkxM0JLMEFNaHhrVzZnNTVURTVNQUoycFklM0QmcmVzZXJ2ZWQ9MD4gaXMNCg0KVVJJID0g c2NoZW1lICI6IiBoaWVyLXBhcnQgWyAiPyIgcXVlcnkgXSBbICIjIiBmcmFnbWVudCBdDQoNCmVh Y2ggVVJJIGlzIGRlZmluZWQgbGlrZSB0aGlzIGFuZCBtdXN0IGhhdmUgYSBjb2xvbi4NCg0KY2hl ZXJzLA0KDQpkcmV0Lg0KDQotLQ0KZXJpayB3aWxkZSB8IG1haWx0bzogZXJpay53aWxkZUBkcmV0 Lm5ldDxtYWlsdG86ZXJpay53aWxkZUBkcmV0Lm5ldD4gfA0KfCBodHRwOi8vZHJldC5uZXQvbmV0 ZHJldDxodHRwczovL25hbTA2LnNhZmVsaW5rcy5wcm90ZWN0aW9uLm91dGxvb2suY29tLz91cmw9 aHR0cCUzQSUyRiUyRmRyZXQubmV0JTJGbmV0ZHJldCZkYXRhPTAyJTdDMDElN0NkdGhhbGVyJTQw bWljcm9zb2Z0LmNvbSU3QzMwMTg0NWI3OWYzNDQxN2I4ZGExMDhkODAwMGZmZTZjJTdDNzJmOTg4 YmY4NmYxNDFhZjkxYWIyZDdjZDAxMWRiNDclN0MxJTdDMCU3QzYzNzI1OTQxNTk4ODUyMzQyNSZz ZGF0YT1Bc0FKVCUyQnpDZGZ0Z050c0IzdEpyN1lqN2hUQmU4JTJCRVMlMkJITGk3UU1VdWRnJTNE JnJlc2VydmVkPTA+IHwNCnwgaHR0cDovL3R3aXR0ZXIuY29tL2RyZXQ8aHR0cHM6Ly9uYW0wNi5z YWZlbGlua3MucHJvdGVjdGlvbi5vdXRsb29rLmNvbS8/dXJsPWh0dHAlM0ElMkYlMkZ0d2l0dGVy LmNvbSUyRmRyZXQmZGF0YT0wMiU3QzAxJTdDZHRoYWxlciU0MG1pY3Jvc29mdC5jb20lN0MzMDE4 NDViNzlmMzQ0MTdiOGRhMTA4ZDgwMDBmZmU2YyU3QzcyZjk4OGJmODZmMTQxYWY5MWFiMmQ3Y2Qw MTFkYjQ3JTdDMSU3QzAlN0M2MzcyNTk0MTU5ODg1MzM0MTkmc2RhdGE9UCUyRkhsZHF4RVQwczRL YTElMkJZQ3c5eGFIbENySXRYSjlrbzhyd0hhJTJCME1hZyUzRCZyZXNlcnZlZD0wPiB8DQo= --_000_BL0PR2101MB102738EF50D7C8AD647E10BBA3B20BL0PR2101MB1027_ Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: base64 PGh0bWwgeG1sbnM6dj0idXJuOnNjaGVtYXMtbWljcm9zb2Z0LWNvbTp2bWwiIHhtbG5zOm89InVy bjpzY2hlbWFzLW1pY3Jvc29mdC1jb206b2ZmaWNlOm9mZmljZSIgeG1sbnM6dz0idXJuOnNjaGVt YXMtbWljcm9zb2Z0LWNvbTpvZmZpY2U6d29yZCIgeG1sbnM6bT0iaHR0cDovL3NjaGVtYXMubWlj cm9zb2Z0LmNvbS9vZmZpY2UvMjAwNC8xMi9vbW1sIiB4bWxucz0iaHR0cDovL3d3dy53My5vcmcv VFIvUkVDLWh0bWw0MCI+DQo8aGVhZD4NCjxtZXRhIGh0dHAtZXF1aXY9IkNvbnRlbnQtVHlwZSIg Y29udGVudD0idGV4dC9odG1sOyBjaGFyc2V0PXV0Zi04Ij4NCjxtZXRhIG5hbWU9IkdlbmVyYXRv ciIgY29udGVudD0iTWljcm9zb2Z0IFdvcmQgMTUgKGZpbHRlcmVkIG1lZGl1bSkiPg0KPHN0eWxl PjwhLS0NCi8qIEZvbnQgRGVmaW5pdGlvbnMgKi8NCkBmb250LWZhY2UNCgl7Zm9udC1mYW1pbHk6 IkNhbWJyaWEgTWF0aCI7DQoJcGFub3NlLTE6MiA0IDUgMyA1IDQgNiAzIDIgNDt9DQpAZm9udC1m YWNlDQoJe2ZvbnQtZmFtaWx5OkNhbGlicmk7DQoJcGFub3NlLTE6MiAxNSA1IDIgMiAyIDQgMyAy IDQ7fQ0KLyogU3R5bGUgRGVmaW5pdGlvbnMgKi8NCnAuTXNvTm9ybWFsLCBsaS5Nc29Ob3JtYWws IGRpdi5Nc29Ob3JtYWwNCgl7bWFyZ2luOjBpbjsNCgltYXJnaW4tYm90dG9tOi4wMDAxcHQ7DQoJ Zm9udC1zaXplOjEyLjBwdDsNCglmb250LWZhbWlseToiVGltZXMgTmV3IFJvbWFuIixzZXJpZjt9 DQphOmxpbmssIHNwYW4uTXNvSHlwZXJsaW5rDQoJe21zby1zdHlsZS1wcmlvcml0eTo5OTsNCglj b2xvcjpibHVlOw0KCXRleHQtZGVjb3JhdGlvbjp1bmRlcmxpbmU7fQ0KYTp2aXNpdGVkLCBzcGFu Lk1zb0h5cGVybGlua0ZvbGxvd2VkDQoJe21zby1zdHlsZS1wcmlvcml0eTo5OTsNCgljb2xvcjpw dXJwbGU7DQoJdGV4dC1kZWNvcmF0aW9uOnVuZGVybGluZTt9DQpwcmUNCgl7bXNvLXN0eWxlLXBy aW9yaXR5Ojk5Ow0KCW1zby1zdHlsZS1saW5rOiJIVE1MIFByZWZvcm1hdHRlZCBDaGFyIjsNCglt YXJnaW46MGluOw0KCW1hcmdpbi1ib3R0b206LjAwMDFwdDsNCglmb250LXNpemU6MTAuMHB0Ow0K CWZvbnQtZmFtaWx5OiJDb3VyaWVyIE5ldyI7fQ0KcC5tc29ub3JtYWwwLCBsaS5tc29ub3JtYWww LCBkaXYubXNvbm9ybWFsMA0KCXttc28tc3R5bGUtbmFtZTptc29ub3JtYWw7DQoJbXNvLW1hcmdp bi10b3AtYWx0OmF1dG87DQoJbWFyZ2luLXJpZ2h0OjBpbjsNCgltc28tbWFyZ2luLWJvdHRvbS1h bHQ6YXV0bzsNCgltYXJnaW4tbGVmdDowaW47DQoJZm9udC1zaXplOjEyLjBwdDsNCglmb250LWZh bWlseToiVGltZXMgTmV3IFJvbWFuIixzZXJpZjt9DQpzcGFuLkVtYWlsU3R5bGUxOA0KCXttc28t c3R5bGUtdHlwZTpwZXJzb25hbC1yZXBseTsNCglmb250LWZhbWlseToiQ2FsaWJyaSIsc2Fucy1z ZXJpZjsNCgljb2xvcjojMUY0OTdEO30NCnNwYW4uSFRNTFByZWZvcm1hdHRlZENoYXINCgl7bXNv LXN0eWxlLW5hbWU6IkhUTUwgUHJlZm9ybWF0dGVkIENoYXIiOw0KCW1zby1zdHlsZS1wcmlvcml0 eTo5OTsNCgltc28tc3R5bGUtbGluazoiSFRNTCBQcmVmb3JtYXR0ZWQiOw0KCWZvbnQtZmFtaWx5 OiJDb3VyaWVyIE5ldyI7fQ0KLk1zb0NocERlZmF1bHQNCgl7bXNvLXN0eWxlLXR5cGU6ZXhwb3J0 LW9ubHk7DQoJZm9udC1zaXplOjEwLjBwdDt9DQpAcGFnZSBXb3JkU2VjdGlvbjENCgl7c2l6ZTo4 LjVpbiAxMS4waW47DQoJbWFyZ2luOjEuMGluIDEuMGluIDEuMGluIDEuMGluO30NCmRpdi5Xb3Jk U2VjdGlvbjENCgl7cGFnZTpXb3JkU2VjdGlvbjE7fQ0KLS0+PC9zdHlsZT48IS0tW2lmIGd0ZSBt c28gOV0+PHhtbD4NCjxvOnNoYXBlZGVmYXVsdHMgdjpleHQ9ImVkaXQiIHNwaWRtYXg9IjEwMjYi IC8+DQo8L3htbD48IVtlbmRpZl0tLT48IS0tW2lmIGd0ZSBtc28gOV0+PHhtbD4NCjxvOnNoYXBl bGF5b3V0IHY6ZXh0PSJlZGl0Ij4NCjxvOmlkbWFwIHY6ZXh0PSJlZGl0IiBkYXRhPSIxIiAvPg0K PC9vOnNoYXBlbGF5b3V0PjwveG1sPjwhW2VuZGlmXS0tPg0KPC9oZWFkPg0KPGJvZHkgbGFuZz0i RU4tVVMiIGxpbms9ImJsdWUiIHZsaW5rPSJwdXJwbGUiPg0KPGRpdiBjbGFzcz0iV29yZFNlY3Rp b24xIj4NCjxwIGNsYXNzPSJNc29Ob3JtYWwiPjxzcGFuIHN0eWxlPSJmb250LXNpemU6MTEuMHB0 O2ZvbnQtZmFtaWx5OiZxdW90O0NhbGlicmkmcXVvdDssc2Fucy1zZXJpZjtjb2xvcjojMUY0OTdE Ij5IaSBUaW0sPG86cD48L286cD48L3NwYW4+PC9wPg0KPHAgY2xhc3M9Ik1zb05vcm1hbCI+PHNw YW4gc3R5bGU9ImZvbnQtc2l6ZToxMS4wcHQ7Zm9udC1mYW1pbHk6JnF1b3Q7Q2FsaWJyaSZxdW90 OyxzYW5zLXNlcmlmO2NvbG9yOiMxRjQ5N0QiPjxvOnA+Jm5ic3A7PC9vOnA+PC9zcGFuPjwvcD4N CjxwIGNsYXNzPSJNc29Ob3JtYWwiPjxzcGFuIHN0eWxlPSJmb250LXNpemU6MTEuMHB0O2ZvbnQt ZmFtaWx5OiZxdW90O0NhbGlicmkmcXVvdDssc2Fucy1zZXJpZjtjb2xvcjojMUY0OTdEIj5Db3Jy ZWN0IHRoZSBjb2xvbiBpcyBub3QgcGFydCBvZiB0aGUgaGllci1wYXJ0LCB0aGUgaGllci1wYXJ0 IGlzIHdoYXQgY29tZXMgYWZ0ZXIgdGhlIGNvbG9uLiZuYnNwOyBSRkMgMzk4NiBzYXlzOjxvOnA+ PC9vOnA+PC9zcGFuPjwvcD4NCjxwIGNsYXNzPSJNc29Ob3JtYWwiPjxzcGFuIHN0eWxlPSJmb250 LXNpemU6MTEuMHB0O2ZvbnQtZmFtaWx5OiZxdW90O0NhbGlicmkmcXVvdDssc2Fucy1zZXJpZjtj b2xvcjojMUY0OTdEIj48bzpwPiZuYnNwOzwvbzpwPjwvc3Bhbj48L3A+DQo8cCBjbGFzcz0iTXNv Tm9ybWFsIj48c3BhbiBzdHlsZT0iZm9udC1zaXplOjEwLjBwdDtmb250LWZhbWlseTomcXVvdDtD b3VyaWVyIE5ldyZxdW90Oztjb2xvcjpibGFjayI+VVJJJm5ic3A7Jm5ic3A7Jm5ic3A7Jm5ic3A7 Jm5ic3A7Jm5ic3A7Jm5ic3A7Jm5ic3A7ID0gc2NoZW1lICZxdW90OzomcXVvdDsgaGllci1wYXJ0 IFsgJnF1b3Q7PyZxdW90OyBxdWVyeSBdIFsgJnF1b3Q7IyZxdW90OyBmcmFnbWVudCBdPG86cD48 L286cD48L3NwYW4+PC9wPg0KPHAgY2xhc3M9Ik1zb05vcm1hbCI+PHNwYW4gc3R5bGU9ImZvbnQt c2l6ZToxMS4wcHQ7Zm9udC1mYW1pbHk6JnF1b3Q7Q2FsaWJyaSZxdW90OyxzYW5zLXNlcmlmO2Nv bG9yOiMxRjQ5N0QiPjxvOnA+Jm5ic3A7PC9vOnA+PC9zcGFuPjwvcD4NCjxwIGNsYXNzPSJNc29O b3JtYWwiPjxzcGFuIHN0eWxlPSJmb250LXNpemU6MTEuMHB0O2ZvbnQtZmFtaWx5OiZxdW90O0Nh bGlicmkmcXVvdDssc2Fucy1zZXJpZjtjb2xvcjojMUY0OTdEIj5Pbmx5IHN0cmluZ3MgdGhhdCBj b25mb3JtIHRvIHRoZSBhYm92ZSBhcmUgVVJJcy48bzpwPjwvbzpwPjwvc3Bhbj48L3A+DQo8cCBj bGFzcz0iTXNvTm9ybWFsIj48c3BhbiBzdHlsZT0iZm9udC1zaXplOjExLjBwdDtmb250LWZhbWls eTomcXVvdDtDYWxpYnJpJnF1b3Q7LHNhbnMtc2VyaWY7Y29sb3I6IzFGNDk3RCI+U28g4oCcZHJv cCNzZDU0ZzU04oCdIGlzIG5vdCBhIFVSSSBiZWNhdXNlIGl0IGRvZXMgbm90IGNvbmZvcm0gdG8g dGhlIGFib3ZlIHN5bnRheCwgYXMgaXQgaGFzIG5vIOKAnDrigJ08bzpwPjwvbzpwPjwvc3Bhbj48 L3A+DQo8cCBjbGFzcz0iTXNvTm9ybWFsIj48c3BhbiBzdHlsZT0iZm9udC1zaXplOjExLjBwdDtm b250LWZhbWlseTomcXVvdDtDYWxpYnJpJnF1b3Q7LHNhbnMtc2VyaWY7Y29sb3I6IzFGNDk3RCI+ PG86cD4mbmJzcDs8L286cD48L3NwYW4+PC9wPg0KPHAgY2xhc3M9Ik1zb05vcm1hbCI+PHNwYW4g c3R5bGU9ImZvbnQtc2l6ZToxMS4wcHQ7Zm9udC1mYW1pbHk6JnF1b3Q7Q2FsaWJyaSZxdW90Oyxz YW5zLXNlcmlmO2NvbG9yOiMxRjQ5N0QiPuKAnGRyb3A6c2Q1NGc1NOKAnSBvbiB0aGUgb3RoZXIg aGFuZCB3b3VsZCBiZSBhIHZhbGlkIFVSSS48bzpwPjwvbzpwPjwvc3Bhbj48L3A+DQo8cCBjbGFz cz0iTXNvTm9ybWFsIj48c3BhbiBzdHlsZT0iZm9udC1zaXplOjExLjBwdDtmb250LWZhbWlseTom cXVvdDtDYWxpYnJpJnF1b3Q7LHNhbnMtc2VyaWY7Y29sb3I6IzFGNDk3RCI+PG86cD4mbmJzcDs8 L286cD48L3NwYW4+PC9wPg0KPHAgY2xhc3M9Ik1zb05vcm1hbCI+PHNwYW4gc3R5bGU9ImZvbnQt c2l6ZToxMS4wcHQ7Zm9udC1mYW1pbHk6JnF1b3Q7Q2FsaWJyaSZxdW90OyxzYW5zLXNlcmlmO2Nv bG9yOiMxRjQ5N0QiPlRoaXMgaXMgd2hhdCBmb2xrcyBhcmUgc2F5aW5nIHdoZW4gdGhleSBzYXkg aWYgeW91IGp1c3QgY2hhbmdlIHRoZSDigJwj4oCdIHRvIGEg4oCcOuKAnSBpbiB5b3VyIGRyYWZ0 IHRoZW4gaXQgYmVjb21lcyBsZWdhbC48bzpwPjwvbzpwPjwvc3Bhbj48L3A+DQo8cCBjbGFzcz0i TXNvTm9ybWFsIj48c3BhbiBzdHlsZT0iZm9udC1zaXplOjExLjBwdDtmb250LWZhbWlseTomcXVv dDtDYWxpYnJpJnF1b3Q7LHNhbnMtc2VyaWY7Y29sb3I6IzFGNDk3RCI+PG86cD4mbmJzcDs8L286 cD48L3NwYW4+PC9wPg0KPHAgY2xhc3M9Ik1zb05vcm1hbCI+PHNwYW4gc3R5bGU9ImZvbnQtc2l6 ZToxMS4wcHQ7Zm9udC1mYW1pbHk6JnF1b3Q7Q2FsaWJyaSZxdW90OyxzYW5zLXNlcmlmO2NvbG9y OiMxRjQ5N0QiPkRhdmU8bzpwPjwvbzpwPjwvc3Bhbj48L3A+DQo8cCBjbGFzcz0iTXNvTm9ybWFs Ij48c3BhbiBzdHlsZT0iZm9udC1zaXplOjExLjBwdDtmb250LWZhbWlseTomcXVvdDtDYWxpYnJp JnF1b3Q7LHNhbnMtc2VyaWY7Y29sb3I6IzFGNDk3RCI+PG86cD4mbmJzcDs8L286cD48L3NwYW4+ PC9wPg0KPGRpdj4NCjxkaXYgc3R5bGU9ImJvcmRlcjpub25lO2JvcmRlci10b3A6c29saWQgI0Ux RTFFMSAxLjBwdDtwYWRkaW5nOjMuMHB0IDBpbiAwaW4gMGluIj4NCjxwIGNsYXNzPSJNc29Ob3Jt YWwiPjxiPjxzcGFuIHN0eWxlPSJmb250LXNpemU6MTEuMHB0O2ZvbnQtZmFtaWx5OiZxdW90O0Nh bGlicmkmcXVvdDssc2Fucy1zZXJpZiI+RnJvbTo8L3NwYW4+PC9iPjxzcGFuIHN0eWxlPSJmb250 LXNpemU6MTEuMHB0O2ZvbnQtZmFtaWx5OiZxdW90O0NhbGlicmkmcXVvdDssc2Fucy1zZXJpZiI+ IFVyaS1yZXZpZXcgJmx0O3VyaS1yZXZpZXctYm91bmNlc0BpZXRmLm9yZyZndDsNCjxiPk9uIEJl aGFsZiBPZiA8L2I+VGltb3RoeSBNY3N3ZWVuZXk8YnI+DQo8Yj5TZW50OjwvYj4gU3VuZGF5LCBN YXkgMjQsIDIwMjAgMTE6MjYgQU08YnI+DQo8Yj5Ubzo8L2I+IEVyaWsgV2lsZGUgJmx0O2VyaWsu d2lsZGVAZHJldC5uZXQmZ3Q7OyB1cmktcmV2aWV3QGlldGYub3JnPGJyPg0KPGI+U3ViamVjdDo8 L2I+IFJlOiBbVXJpLXJldmlld10gUmVxdWVzdCBmb3IgcmV2aWV3PG86cD48L286cD48L3NwYW4+ PC9wPg0KPC9kaXY+DQo8L2Rpdj4NCjxwIGNsYXNzPSJNc29Ob3JtYWwiPjxvOnA+Jm5ic3A7PC9v OnA+PC9wPg0KPGRpdj4NCjxwIGNsYXNzPSJNc29Ob3JtYWwiPkhpIEVyaWssJm5ic3A7IDxvOnA+ PC9vOnA+PC9wPg0KPC9kaXY+DQo8ZGl2Pg0KPHAgY2xhc3M9Ik1zb05vcm1hbCI+PG86cD4mbmJz cDs8L286cD48L3A+DQo8L2Rpdj4NCjxkaXY+DQo8cCBjbGFzcz0iTXNvTm9ybWFsIj5UaGFuayB5 b3UsIEkgd2lsbCBoYXZlIGFub3RoZXIgbG9vayBhdCBteSByZWZlcmVuY2UgdG8gc2VjdGlvbiAz LiZuYnNwOyAmbmJzcDsNCjxvOnA+PC9vOnA+PC9wPg0KPC9kaXY+DQo8ZGl2Pg0KPHAgY2xhc3M9 Ik1zb05vcm1hbCI+V291bGQgeW91IGFncmVlIHRoYXQgaW4gJnF1b3Q7PGEgaHJlZj0iaHR0cHM6 Ly9pZXRmLm9yZyI+aHR0cHM6Ly9pZXRmLm9yZzwvYT4mcXVvdDsgdGhlIGNvbG9uIGlzIG5vdCBw YXJ0IG9mIHRoZSBoaWVyLXBhcnQ/Jm5ic3A7DQo8bzpwPjwvbzpwPjwvcD4NCjwvZGl2Pg0KPGJs b2NrcXVvdGUgc3R5bGU9Im1hcmdpbi10b3A6NS4wcHQ7bWFyZ2luLWJvdHRvbTo1LjBwdCI+DQo8 ZGl2Pg0KPHAgY2xhc3M9Ik1zb05vcm1hbCI+T24gTWF5IDI0LCAyMDIwIGF0IDEyOjAyIFBNIEVy aWsgV2lsZGUgJmx0OyA8YSBocmVmPSJtYWlsdG86ZXJpay53aWxkZUBkcmV0Lm5ldCI+DQplcmlr LndpbGRlQGRyZXQubmV0PC9hPiZndDsgd3JvdGU6IDxvOnA+PC9vOnA+PC9wPg0KPC9kaXY+DQo8 ZGl2Pg0KPHAgY2xhc3M9Ik1zb05vcm1hbCI+PG86cD4mbmJzcDs8L286cD48L3A+DQo8L2Rpdj4N CjxkaXY+DQo8cCBjbGFzcz0iTXNvTm9ybWFsIj48bzpwPiZuYnNwOzwvbzpwPjwvcD4NCjwvZGl2 Pg0KPGRpdj4NCjxwIGNsYXNzPSJNc29Ob3JtYWwiPmhleSB0aW0uIDxvOnA+PC9vOnA+PC9wPg0K PC9kaXY+DQo8ZGl2Pg0KPHAgY2xhc3M9Ik1zb05vcm1hbCI+PG86cD4mbmJzcDs8L286cD48L3A+ DQo8L2Rpdj4NCjxkaXY+DQo8cCBjbGFzcz0iTXNvTm9ybWFsIj5PbiAyMDIwLTA1LTI0IDE3OjUz LCBUaW1vdGh5IE1jc3dlZW5leSB3cm90ZTogPG86cD48L286cD48L3A+DQo8L2Rpdj4NCjxibG9j a3F1b3RlIHN0eWxlPSJtYXJnaW4tdG9wOjUuMHB0O21hcmdpbi1ib3R0b206NS4wcHQiPg0KPGRp dj4NCjxwIGNsYXNzPSJNc29Ob3JtYWwiPlllcywgSSBhZ3JlZSBhbmQgdW5kZXJzdGFuZCB0aGF0 IHRoZSBzYW1lIHdheSBhcyB5b3UuJm5ic3A7ICZuYnNwO0J1dCB3aGVuIHRoZSAmcXVvdDsjJnF1 b3Q7DQo8bzpwPjwvbzpwPjwvcD4NCjwvZGl2Pg0KPGRpdj4NCjxwIGNsYXNzPSJNc29Ob3JtYWwi PmxlYXZlcyB0aGUgY2xpZW50IGl0IGlzIG5vdCBsZWF2aW5nIGFzIGEgZnJhZ21lbnQsIDxvOnA+ PC9vOnA+PC9wPg0KPC9kaXY+DQo8L2Jsb2NrcXVvdGU+DQo8ZGl2Pg0KPHAgY2xhc3M9Ik1zb05v cm1hbCI+d2hhdCBwZW9wbGUgYXJlIHRlbGxpbmcgeW91IGlzIHRoYXQgJnF1b3Q7IyZxdW90OyBh bmQgYW55dGhpbmcgZm9sbG93aW5nIGl0IG5ldmVyDQo8bzpwPjwvbzpwPjwvcD4NCjwvZGl2Pg0K PGRpdj4NCjxwIGNsYXNzPSJNc29Ob3JtYWwiPmxlYXZlcyB0aGUgY2xpZW50LCBieSBkZWZpbml0 aW9uLiA8bzpwPjwvbzpwPjwvcD4NCjwvZGl2Pg0KPGRpdj4NCjxwIGNsYXNzPSJNc29Ob3JtYWwi PjxvOnA+Jm5ic3A7PC9vOnA+PC9wPg0KPC9kaXY+DQo8YmxvY2txdW90ZSBzdHlsZT0ibWFyZ2lu LXRvcDo1LjBwdDttYXJnaW4tYm90dG9tOjUuMHB0Ij4NCjxkaXY+DQo8cCBjbGFzcz0iTXNvTm9y bWFsIj5pdCBpcyBsZWF2aW5nIGFzIGEgPG86cD48L286cD48L3A+DQo8L2Rpdj4NCjxkaXY+DQo8 cCBjbGFzcz0iTXNvTm9ybWFsIj53YXkgdG8gc2VwYXJhdGUgdGhlIFVSSSBjb21wb25lbnRzLCAm bHQ7c2NoZW1lJmd0OyBhbmQgJmx0O3BhdGgmZ3Q7IG9yIGZvciBodHRwIGl0DQo8bzpwPjwvbzpw PjwvcD4NCjwvZGl2Pg0KPGRpdj4NCjxwIGNsYXNzPSJNc29Ob3JtYWwiPndvdWxkIGJlIHNlcGFy YXRpbmcgJmx0O3NjaGVtZSZndDsgYW5kICZsdDthdXRob3JpdHkmZ3Q7LiZuYnNwOyBJdCBpcyB0 aGlzIHRoYXQgbWFrZXMgbWUNCjxvOnA+PC9vOnA+PC9wPg0KPC9kaXY+DQo8ZGl2Pg0KPHAgY2xh c3M9Ik1zb05vcm1hbCI+YmVsaWV2ZSB0aGF0IGV2ZW4gaWYgdGhlIGNvbG9uIGlzIHJlcXVpcmVk IGZvciBodHRwIHJlc29sdXRpb24sIGl0IGlzDQo8bzpwPjwvbzpwPjwvcD4NCjwvZGl2Pg0KPGRp dj4NCjxwIGNsYXNzPSJNc29Ob3JtYWwiPm5vdCBuZWNlc3NhcmlseSByZXF1aXJlZCBmb3IgYWxs IFVSSS4gPG86cD48L286cD48L3A+DQo8L2Rpdj4NCjwvYmxvY2txdW90ZT4NCjxkaXY+DQo8cCBj bGFzcz0iTXNvTm9ybWFsIj50aGlzIGRpc2N1c3Npb24gY291bGQgYmUgbW9yZSBwcm9kdWN0aXZl IGlmIHlvdSBoYWQgYSBicmllZiBsb29rIGF0IHRoZQ0KPG86cD48L286cD48L3A+DQo8L2Rpdj4N CjxkaXY+DQo8cCBjbGFzcz0iTXNvTm9ybWFsIj5zcGVjcyB5b3UncmUgZGVwZW5kaW5nIG9uLiB0 aGUgdmVyeSBmaXJzdCBydWxlIHNob3duIGluIDxvOnA+DQo8L286cD48L3A+DQo8L2Rpdj4NCjxk aXY+DQo8cCBjbGFzcz0iTXNvTm9ybWFsIj48YSBocmVmPSJodHRwczovL25hbTA2LnNhZmVsaW5r cy5wcm90ZWN0aW9uLm91dGxvb2suY29tLz91cmw9aHR0cHMlM0ElMkYlMkZ0b29scy5pZXRmLm9y ZyUyRmh0bWwlMkZyZmMzOTg2JTIzc2VjdGlvbi0zJmFtcDtkYXRhPTAyJTdDMDElN0NkdGhhbGVy JTQwbWljcm9zb2Z0LmNvbSU3QzMwMTg0NWI3OWYzNDQxN2I4ZGExMDhkODAwMGZmZTZjJTdDNzJm OTg4YmY4NmYxNDFhZjkxYWIyZDdjZDAxMWRiNDclN0MxJTdDMCU3QzYzNzI1OTQxNTk4ODUyMzQy NSZhbXA7c2RhdGE9OFNkRlBJUVBtZlBPZWZFWWclMkZ5MTNCSzBBTWh4a1c2ZzU1VEU1TUFKMnBZ JTNEJmFtcDtyZXNlcnZlZD0wIiB0YXJnZXQ9Il9ibGFuayI+aHR0cHM6Ly90b29scy5pZXRmLm9y Zy9odG1sL3JmYzM5ODYjc2VjdGlvbi0zPC9hPg0KIGlzIDxvOnA+PC9vOnA+PC9wPg0KPC9kaXY+ DQo8ZGl2Pg0KPHAgY2xhc3M9Ik1zb05vcm1hbCI+PG86cD4mbmJzcDs8L286cD48L3A+DQo8L2Rp dj4NCjxkaXY+DQo8cCBjbGFzcz0iTXNvTm9ybWFsIj5VUkkgPSBzY2hlbWUgJnF1b3Q7OiZxdW90 OyBoaWVyLXBhcnQgWyAmcXVvdDs/JnF1b3Q7IHF1ZXJ5IF0gWyAmcXVvdDsjJnF1b3Q7IGZyYWdt ZW50IF0gPG86cD4NCjwvbzpwPjwvcD4NCjwvZGl2Pg0KPGRpdj4NCjxwIGNsYXNzPSJNc29Ob3Jt YWwiPjxvOnA+Jm5ic3A7PC9vOnA+PC9wPg0KPC9kaXY+DQo8ZGl2Pg0KPHAgY2xhc3M9Ik1zb05v cm1hbCI+ZWFjaCBVUkkgaXMgZGVmaW5lZCBsaWtlIHRoaXMgYW5kIG11c3QgaGF2ZSBhIGNvbG9u LiA8bzpwPjwvbzpwPjwvcD4NCjwvZGl2Pg0KPGRpdj4NCjxwIGNsYXNzPSJNc29Ob3JtYWwiPjxv OnA+Jm5ic3A7PC9vOnA+PC9wPg0KPC9kaXY+DQo8ZGl2Pg0KPHAgY2xhc3M9Ik1zb05vcm1hbCI+ Y2hlZXJzLCA8bzpwPjwvbzpwPjwvcD4NCjwvZGl2Pg0KPGRpdj4NCjxwIGNsYXNzPSJNc29Ob3Jt YWwiPjxvOnA+Jm5ic3A7PC9vOnA+PC9wPg0KPC9kaXY+DQo8ZGl2Pg0KPHAgY2xhc3M9Ik1zb05v cm1hbCI+ZHJldC4gPG86cD48L286cD48L3A+DQo8L2Rpdj4NCjxkaXY+DQo8cCBjbGFzcz0iTXNv Tm9ybWFsIj48bzpwPiZuYnNwOzwvbzpwPjwvcD4NCjwvZGl2Pg0KPGRpdj4NCjxwIGNsYXNzPSJN c29Ob3JtYWwiPi0tIDxvOnA+PC9vOnA+PC9wPg0KPC9kaXY+DQo8ZGl2Pg0KPHAgY2xhc3M9Ik1z b05vcm1hbCI+ZXJpayB3aWxkZSB8IG1haWx0bzogPGEgaHJlZj0ibWFpbHRvOmVyaWsud2lsZGVA ZHJldC5uZXQiPmVyaWsud2lsZGVAZHJldC5uZXQ8L2E+IHwNCjxvOnA+PC9vOnA+PC9wPg0KPC9k aXY+DQo8ZGl2Pg0KPHAgY2xhc3M9Ik1zb05vcm1hbCI+fCA8YSBocmVmPSJodHRwczovL25hbTA2 LnNhZmVsaW5rcy5wcm90ZWN0aW9uLm91dGxvb2suY29tLz91cmw9aHR0cCUzQSUyRiUyRmRyZXQu bmV0JTJGbmV0ZHJldCZhbXA7ZGF0YT0wMiU3QzAxJTdDZHRoYWxlciU0MG1pY3Jvc29mdC5jb20l N0MzMDE4NDViNzlmMzQ0MTdiOGRhMTA4ZDgwMDBmZmU2YyU3QzcyZjk4OGJmODZmMTQxYWY5MWFi MmQ3Y2QwMTFkYjQ3JTdDMSU3QzAlN0M2MzcyNTk0MTU5ODg1MjM0MjUmYW1wO3NkYXRhPUFzQUpU JTJCekNkZnRnTnRzQjN0SnI3WWo3aFRCZTglMkJFUyUyQkhMaTdRTVV1ZGclM0QmYW1wO3Jlc2Vy dmVkPTAiIHRhcmdldD0iX2JsYW5rIj4NCmh0dHA6Ly9kcmV0Lm5ldC9uZXRkcmV0PC9hPiB8IDxv OnA+PC9vOnA+PC9wPg0KPC9kaXY+DQo8ZGl2Pg0KPHAgY2xhc3M9Ik1zb05vcm1hbCI+fCA8YSBo cmVmPSJodHRwczovL25hbTA2LnNhZmVsaW5rcy5wcm90ZWN0aW9uLm91dGxvb2suY29tLz91cmw9 aHR0cCUzQSUyRiUyRnR3aXR0ZXIuY29tJTJGZHJldCZhbXA7ZGF0YT0wMiU3QzAxJTdDZHRoYWxl ciU0MG1pY3Jvc29mdC5jb20lN0MzMDE4NDViNzlmMzQ0MTdiOGRhMTA4ZDgwMDBmZmU2YyU3Qzcy Zjk4OGJmODZmMTQxYWY5MWFiMmQ3Y2QwMTFkYjQ3JTdDMSU3QzAlN0M2MzcyNTk0MTU5ODg1MzM0 MTkmYW1wO3NkYXRhPVAlMkZIbGRxeEVUMHM0S2ExJTJCWUN3OXhhSGxDckl0WEo5a284cndIYSUy QjBNYWclM0QmYW1wO3Jlc2VydmVkPTAiIHRhcmdldD0iX2JsYW5rIj4NCmh0dHA6Ly90d2l0dGVy LmNvbS9kcmV0PC9hPiB8IDxvOnA+PC9vOnA+PC9wPg0KPC9kaXY+DQo8L2Jsb2NrcXVvdGU+DQo8 L2Rpdj4NCjwvYm9keT4NCjwvaHRtbD4NCg== --_000_BL0PR2101MB102738EF50D7C8AD647E10BBA3B20BL0PR2101MB1027_-- From nobody Wed May 27 16:42:42 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 81C143A0DB0 for ; Wed, 27 May 2020 16:42:40 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.795 X-Spam-Level: X-Spam-Status: No, score=-1.795 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, HTML_MESSAGE=0.001, MIME_HTML_ONLY=0.1, RCVD_IN_MSPIKE_H3=0.001, RCVD_IN_MSPIKE_WL=0.001, SPF_NONE=0.001, URIBL_BLOCKED=0.001] autolearn=no autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id B0Y5ZftMSPCb for ; Wed, 27 May 2020 16:42:38 -0700 (PDT) Received: from mout.perfora.net (mout.perfora.net [74.208.4.197]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 720143A0DAE for ; Wed, 27 May 2020 16:42:38 -0700 (PDT) Received: from oxusgaltgw01.schlund.de ([10.72.72.47]) by mrelay.perfora.net (mreueus004 [74.208.5.2]) with ESMTPSA (Nemesis) id 1MOAS5-1jOsC41rZJ-00OZle for ; Thu, 28 May 2020 01:42:37 +0200 Date: Wed, 27 May 2020 19:42:35 -0400 (EDT) From: Timothy Mcsweeney Reply-To: Timothy Mcsweeney To: uri-review@ietf.org Message-ID: <1804062312.403587.1590622955990@email.ionos.com> In-Reply-To: <745178906.42051.1590103115859@email.ionos.com> References: <491516506.246380.1589851279474@email.ionos.com> <1630462326.97358.1589928036619@email.ionos.com> <217485042.439703.1589938351012@email.ionos.com> <745178906.42051.1590103115859@email.ionos.com> MIME-Version: 1.0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-Priority: 3 Importance: Normal X-Originating-Client: open-xchange-appsuite X-Mailer: Open-Xchange Mailer v7.10.1-Rev31 X-Provags-ID: V03:K1:qeQVbjxTvpN+XCqooKoo/H3nJS1s+jbYomRJhQrdLccumi9xx/f A6yO+KZyHSunisAgsiVRHAcJ4NQ8tgQyZxWjvMNy/YxtDkbiFzwOsraJpnha7YvMS/Tf52b 3V/CXCi/dfID8Az2mmYNgVEpdHvCdYa+hQKIFeWF0J17Wpi7S9p9SX9vw9ayNL47sYWC3ZE dMwOmAf8bDHJOnuLnzNpA== X-UI-Out-Filterresults: notjunk:1;V03:K0:J4bxOCdi1MQ=:txGEKDEns3a9PxeOcbewN9 s9RAP4PO8mcrtbAhHjO1u58s2tiuvxktg+RUiryxhovMhq35XI1SwxNJloB1/lhNBJsSFUg1I YTSHQyACgmEEZCNlIA/nrubE8zxaP9Y4t56qh4eXg6Lv5sXHHjfgS21HmOc/ZNt4xKLixTsBQ aPufzG2vScG2x+cNDCDmH5bsi6bbSvPjY4f4dac/kwhcJJzsKotVm63HaqJgu0gkcgR1dgcH4 TIQ3d/K984oI0sIbz4cp7OmihmCUPrLBJCfQ38Xtan8CJXKxQ4gUO7eAjf7SZ89iqG58TCeUm oy6WnfrwYYeidkDKERNXiuYTR7tysQopvc2zduAGQdiNqQ012O/LT8yIpB2rm2XiTEOXp7tgS 8VpfKZDi8lBYADR+qLW3iVcdWf5kYowVLt8O3C32x98DHaMt8y5fCQsxTJxTVOZ3zrsqfSLlQ djuBbD9YJ3PpI+Yt99MhGvZqvHNat3Lv/pBjKxBFgdtPWU7k1zMQ/saAgGwuehUSsXYQCrJH5 be/2F5AFJDgpq2htBgdvL/9KDwwbV0eAnkg9lcRKOYV//qPeIRdK+Qn1YQb4V8kbYk7rxzjvv 6nD46P+oXWdUkqnsdPAWMJ6tzn8xepWGfwBwVVyJ/iYOYDZXnJjfsYXh+uU+cUEebi145UuDI 9XKPgl/9uQOG8MTgsZRM4quYSNga7gv73WYxNIuaiFeqiyrA8ulpzDo/s2me5uLYGKx140Eoa RTDBYuw7DdTPXqa9AJoWhAlCXX3vhw+Qm2tG4fUR3+L3L04B5tU7c25lh/wfSYt2/r4pM574V RcbmXsx7rqNwt1m/50huy6OxSTr/nFXXCt/Z+IlyYcjbcAtejMWfbyNE90Rd/fSD3ZJ9EUW Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 27 May 2020 23:42:41 -0000 =20 =20
Just putting this conversation up here to show that Ted brought up some = good points that I have fixed in the second draft.
On May 21, 2020 at 7:18 PM Timothy Mcsweeney <tim@dropnumber.com> = wrote:=20

Hi Ted, 
I have a question for you.  In your last couple emails when you sa= id the words "permanent identifier", did you mean:

the string always matches the same object forever
-or-
the string will always be an identifier for these particular types of o= bjects
-or-
the string is disposable and there will never be another string like it= again.

Thanks, 
Tim
On May 20, 2020 at 6:42 PM Ted Hardie <=20 ted.ietf@gmail.com> wrote= :


On Tue, May 19, 2020 at 6:32 PM Timothy Mcsweeney <=20 tim@dropnumber.com> wrote= :
>
Ted,
Thank you very much for the feedback. Would I be correct in deducing = from your reply that if the 'drop' scheme remained a locator that you would= recommend it remain a URI over a URN?
Tim

Because you can use the DDDS to get from a URN to the a retrieval
step, I'm not sure that's the critical property for me. I think for
me the difference is whether the drop-string is unique or not. As an
example, a URN with a NBN
through a resolver to identify a specific resource. In cases like
NBNs (or RFC numbers, for which there are also URNs), the number is
never reassigned; the issuer guarantees that the NBN will change if
the resource changes.

If you are constructing an identifier that is unique but will have
internal references which change (e.g. if the telephone number or
address associated with it change), you can still use a URN, but it
will be associated will be a meta-identifier for the collection of
changing versions. That's how vCard's CLIENTPIDMAP works, for
example. It sort-of sounds like drop-strings would be dereferenable
versions of this, via something like
CLIENTPIDMAP.well-known-domain.example. The usefulness of that gets
back to the question we discussed before,of whether these are mnemonic
or not; discovering the right drop-string to use becomes a major part
of the exercise.

In general, I think the vCard case might be a useful one for you to
spend some time with, because it may be easier to communicate what
drop-string will do if you relate it to an existing case.

regards,

Ted Hardie


>
Hi Tim,
On Tue, May 19, 2020 at 3:40 PM Timothy Mcsweeney <=20 tim@dropnumber.com> wrot= e:
Hi Ted,
Thank you for taking the time to have a look at the draft. I had not = considered the use of more than one domain. I will be sure to clarify that = there will only be one second level domain used for http. Because I am limi= ted to four flags in the DDDS, at this time I would say my intent would be = the same as listed. You are probably right when saying that section will ne= ed a rewrite.
Your statement about the drop-string functioning as a permanent ident= ifier with the current telephone number, address, or other contact methods = being available as a retrieved resource is spot on but in my head it is a l= ocator. I'm going to give that some more thought. Generally speaking, is th= is draft something that you would personally find appealing to use?
If this intended to be a permanent identifier and you intend to use t= he DDDS, I would suggest you consider either a URN or, if you want to look = outside the IETF, at an implementation of the handle system, which is curre= ntly maintained by the DONA foundation. If you stick with a URN, the result= would be a string like this:
urn:drop:nss-specific-string
Drop is the namespace identifier (NID) in this case. The issuer assig= ned that NID is the issuer of names-specific-strings and has to maintain ce= rtain guarantees related to uniqueness, which may or may not work for you d= epending on your application model. There is, however, already a specificat= ion for how to use the DDDS to retrieve URNs (RFC 3402) as well as some exp= erience with S-NAPTR (RFC 3958), which may simplify your deployment.
Your question about whether or not I feel this would be appealing to = use is a little hard to answer without knowing more about the construction = of the resources it returns and the creation of the strings. If they are es= sentially random, the deployment model is hard to get going because the use= rs are trading a series of mnemonic strings for an opaque one. vCards (RFC = 6350), for example, can contain a UUID in URN form; this is unique, but not= memorable. Systems can use it to confirm that a vCard is a new entry in a = contacts database, but the URN UUIDs do not really replace any of the entri= es in the vCard in other contexts. If the strings are not random, then you = get markets in the names, along with risks of squatting and so on. Even for= the opaque strings there have been such markets (sales of mnemonic telepho= ne numbers, for example, where either keypad mapping or repeating numbers a= re valued as easy to remember). Those markets (for domain names, twitter ha= ndles, and so on) tend to produce a lot of work in balancing the needs of t= hose trying to maintain trademarks and those wishing to create new marks an= d identifiers.
regards,
Ted Hardie
>
Sincerely,
Tim
On May 19, 2020 at 11:45 AM Ted Hardie <=20 ted.ietf@gmail.com> wrot= e:
Hi Tim,
Thanks for the pointer to the draft. I think there are two issues her= e which are large enough that you may wish to think about the implied archi= tecture. The first is a syntactic issue: the use of "#" as the only delimit= er in the proposed URIs. As RFC 3986 describes it, the "#" delimiter is use= d for identifying fragments and is thus dependent on the MIME type of the r= etrieved object:
The fragment's format and resolution is therefore
dependent on the media type [RFC2046] of a potentially retrieved
representation, even though such a retrieval is only performed if the
URI is dereferenced.
This does not appear to match your usage. The usage you appear to be = seeking is a transposition of the string to a subdomain of a well-known dom= ain, so that a client can attempt retrieval via the three methods you enume= rate; it is not clear from the document whether there will ever be more tha= n one permitted domain here. A simpler implementation would appear to be dr= op:drop-string.well-known-domain.example.
Second, your document appears to imply that the drop string is used t= o augment existing telephone numbers and addresses, but it is not terribly = clear how it does this. One interpretation might be that the drop-string fu= nctions as a permanent identifier with the current telephone number, addres= s, or other contact methods being available as a retrieved resource. This s= ection:
Primarily functioning as a locator there are three ways to get to a
'drop' URI resource, http, srv records, and private resolution for
anything not found using the previous two methods. The first, or
default, action is when an application invokes the 'drop' URI it will
cause a lookup for matching application information starting with an = A
record [RFC1035], then on to Service records [RFC2782], and then on t= o
other available records that may offer a new rule set for resolution.
raises a problem with this approach: the records returned by SRV are = fundamentally different, in that they are onward pointers to other domains = and resolutions. If the implication is that HTTP is always used to retrieve= drop records and the appropriate server is discovered by either using an A= record, an SRV record, or private resolution, then this section needs a ma= jor re-write (to include AAAA records and to clarify the intent). It's also= not clear what long lived utility a new scheme serves here if the result i= s always=20 https://some-string.discovered-domain.example/= .
If there were a different guarantee of uniqueness than the DNS, this = would seem closer to a URN than other URI forms, or possibly an implementat= ion of the handle system (as DOIs are). There is, unfortunately, not enough= detail in the draft on the overall system to be confident of that.
regards,
Ted Hardie
>
On Mon, May 18, 2020 at 6:21 PM Timothy Mcsweeney <=20 tim@dropnumber.com> wrot= e:
Hello everyone,
Sincerely,
Tim McSweeney
_______________________________________________
Uri-review mailing list
>
>
>
>
>

 
=20 From nobody Wed May 27 17:05:15 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 912D23A0DD4 for ; Wed, 27 May 2020 17:05:13 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.695 X-Spam-Level: X-Spam-Status: No, score=-1.695 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, HTML_MESSAGE=0.001, HTTPS_HTTP_MISMATCH=0.1, MIME_HTML_ONLY=0.1, RCVD_IN_MSPIKE_H3=0.001, RCVD_IN_MSPIKE_WL=0.001, SPF_NONE=0.001, URIBL_BLOCKED=0.001] autolearn=no autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id mcsmK2PbeRF0 for ; Wed, 27 May 2020 17:05:12 -0700 (PDT) Received: from mout.perfora.net (mout.perfora.net [74.208.4.194]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 32E1E3A0DD0 for ; Wed, 27 May 2020 17:05:12 -0700 (PDT) Received: from oxusgaltgw10.schlund.de ([10.72.72.56]) by mrelay.perfora.net (mreueus002 [74.208.5.2]) with ESMTPSA (Nemesis) id 0MbfKV-1jLCHS1kyD-00Iyi6 for ; Thu, 28 May 2020 02:05:11 +0200 Date: Wed, 27 May 2020 20:05:11 -0400 (EDT) From: Timothy Mcsweeney Reply-To: Timothy Mcsweeney To: uri-review@ietf.org Message-ID: <1081815563.141711.1590624311343@email.ionos.com> In-Reply-To: References: <491516506.246380.1589851279474@email.ionos.com> <5EC9B257.31362.CC5E003@dan.tobias.name> <1783049000.100771.1590323508943@email.ionos.com> <5ECA8A94.23977.101292FE@dan.tobias.name> <1426881880.158099.1590335585858@email.ionos.com> <94368b41-c15b-da2c-421d-fdd9300be6e9@dret.net> <1310141163.159340.1590344745080@email.ionos.com> MIME-Version: 1.0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-Priority: 3 Importance: Normal X-Mailer: Open-Xchange Mailer v7.10.1-Rev31 X-Originating-Client: open-xchange-appsuite X-Provags-ID: V03:K1:ndcGDGK/DTq0ii+pnD49OjZd8G3arrbysUa3uGB81B0Qsg9kudJ CJwdBHt5ryUsHfohMdPadFtDtssY6wLSWtN5p0JIotyLJU1l97Jswldci3tf7IVrQPbIUOi xfxE1gCN680bEhocJjBSHs3b1HweAfTjedc2EIOLhadjD8AaqGz4z9O32u2uolX1Z/rkGJc p6b8kn5uAGWEJXP/If37A== X-UI-Out-Filterresults: notjunk:1;V03:K0:6D0M3gXd1EY=:v+xTbseXg/Z/Tw/8+/kcl3 5g4dmWjabw7ly2iSABe13m/VbNRT8BAiq+2UInKE9h8joIehhOTruWcrhMMBwmqTRBF2I89a2 N++qrS1iwSh/NpX0hbWquT7URXHjm34l7K5TJccq1P2FkxMMagQxMiK1cSLzTes6ixLsiABj0 5Zqrq6F+l622un/24J3A5D8J39/GkwiYi8SrbAjxlEQgx6CBglQSn1RSb0qhf7a10GpFSKqby R/iVnh5y8DLUowR36vDUB07Ma1o0PHOZM3XZDFEYE5p3QPhMqnNVfESciwBFGe5sCj+QdODKN eALzIbBFnaY1fWh050zFEwmlf54MZQ/6NhOxvcfRt8zQPErU+iSslubflFTwcmYBXpzddAymg Ev2a5kYe5Fb6sfHwfPHcxNdZObQYRQ5VjKJrV+MI+PXrTGet9+hF/FflH+MwEPMSOkrp3UBSd 7wBf4UwJ2Ju/z+ZjH7C2KmJjLlemTZG1pKjbHSf5x7BfaPXrpRfXnZ7fvtNbcNsBZGOu4lWou 5iEWjgROapHuSWgIE/fQe5BVRWEBl3m3rNw3f5omeFooMzxfLqW/8TxuiE/J5XlVJyKr81pfU sKc//9ikVx/pHZcFll3otGV6JECZibSYYFdX944zTjC4/w0F27bRHRmjor+MXkxJC5fcb1RaB A/iovbjF6JjzBYlVxXo/ipagvNIsyaeWJvACQ6rCyWLhKOw/HEHUpOOmRX+X9FCLeeJB5+IDj d+b1YHdM5EecUhmKkX+MBwUv4zHU0TxySmHrLNuT+0oC91NORA7/Hid7IkTW+Po9O0IxME6rr YM58VUESjVt9pNF03r5JhT4PkzqlCnJEvJQyQ9bXd6/vwywLHdUTE7lcrRM8ArskicZOvw9 Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 28 May 2020 00:05:14 -0000 =20 =20
Hi Dave, 

If the other six gen-delims from the reserved set were safe and valid, = would you oppose their use in URIs?

Tim



On May 24, 2020 at 6:08 PM Dave Thaler <dthaler@microsoft.com> wro= te:=20

Hi Tim,

 

Correct the colon is no= t part of the hier-part, the hier-part is what comes after the colon. = RFC 3986 says:

 

URI     = ;    =3D scheme ":" hier-part [ "?" query ] [ "#" fragment ]=

 

Only strings that confo= rm to the above are URIs.

So =E2=80=9Cdrop#sd54g5= 4=E2=80=9D is not a URI because it does not conform to the above syntax, as= it has no =E2=80=9C:=E2=80=9D

 

=E2=80=9Cdrop:sd54g54= =E2=80=9D on the other hand would be a valid URI.

 

This is what folks are = saying when they say if you just change the =E2=80=9C#=E2=80=9D to a =E2=80= =9C:=E2=80=9D in your draft then it becomes legal.

 

Dave

 

From: Uri-review &= lt;uri-review-bounces@ietf.org> On Behalf Of Timothy Mc= sweeney
Sent: Sunday, May 24, 2020 11:26 AM
= To: Erik Wilde <erik.wilde@dret.net>; uri-review@ietf.orgSubject: Re: [Uri-review] Request for review


Hi Erik, 


Thank you, I will have another lo= ok at my reference to section 3.   

Would you agree that in "https://ietf.org" the colon is not part of the hi= er-part? 

On May 24, 2020 at 12:02 PM Erik= Wilde < erik.wilde@dret.net= > wrote:



hey tim.


On 2020-05-24 17:53, Timothy Mcs= weeney wrote:

Yes, I agree and understand tha= t the same way as you.   But when the "#"

leaves the client it is not lea= ving as a fragment,

what people are telling you is t= hat "#" and anything following it never

leaves the client, by definition= .


it is leaving as a

way to separate the URI compone= nts, <scheme> and <path> or for http it

would be separating <scheme&= gt; and <authority>.  It is this that makes me

believe that even if the colon = is required for http resolution, it is

not necessarily required for al= l URI.

this discussion could be more pr= oductive if you had a brief look at the

specs you're depending on. the v= ery first rule shown in


URI =3D scheme ":" hier-part [ "= ?" query ] [ "#" fragment ]


each URI is defined like this an= d must have a colon.


cheers,


dret.


--

erik wilde | mailto: erik.wilde@dret.net |


 
=20 From nobody Wed May 27 17:47:08 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 96BEF3A00D3 for ; Wed, 27 May 2020 17:47:06 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -2.001 X-Spam-Level: X-Spam-Status: No, score=-2.001 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, DKIMWL_WL_HIGH=-0.001, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, DKIM_VALID_EF=-0.1, HTML_MESSAGE=0.001, HTTPS_HTTP_MISMATCH=0.1, RCVD_IN_MSPIKE_H2=-0.001, SPF_PASS=-0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no Authentication-Results: ietfa.amsl.com (amavisd-new); dkim=pass (1024-bit key) header.d=microsoft.com Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id WfE4XkaqsTZF for ; Wed, 27 May 2020 17:47:04 -0700 (PDT) Received: from NAM12-BN8-obe.outbound.protection.outlook.com (mail-bn8nam12on2122.outbound.protection.outlook.com [40.107.237.122]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 8293A3A00D2 for ; Wed, 27 May 2020 17:47:04 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=QVUFss1t7u2c/6HAXfPUdV4c/0s4/c+KL1eRG2n9ziQLxfBOBIyaUdYgqFNh+02yJfho7nVWs9M2j+e7lPhxOAllfx0hUo3Bdkgq7yjVx0nGzDI44LeKeL7YR0xudAlpqz3Lr4y4BIB5b0jLYqneg3LbM9bZnXKOV+8+tcNY310YbbUPthY0J5E5jyEKZ24BwHazeQcpmS3nT54VT1p3tMzgrKxaOsWoIre7WhJgZGNcxAIQGI3acuSxrLF0qHQ9QCpDhXof4AO/kHMCFqzVY4F01lbM3k3xXjNNzIoxLi8L8/sRAvIBDdZLDhzEyHPU8a2xcNMxK9RFfWFqtLNJWw== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=ovuraEvPAyyeq9IvetDTrGvGbMWLADpiqBDCJzaJz08=; b=cic765EVL8UoNYU7LE5zCsbLQt9HbqavmBK0zeVyGUbS8lHRhICLIZjbzbNiKmUh8FI7dfw17mLd1LYttwKd7CLFPofVVWmHSk3EYbp4FSQgr9fyHeIinkWWM4IWut/QqJSWdcSv0zoTBGzjXFVFNBZpbbbuz3ePunxn1LWxVGW/zOuD6x2UlI7AjXR/rKLJn5UhZB6/kNAO4QDOGt/WDXKhHhn7OXAi8BZhBDUG5qubi/FTQgWHP2KFNUR8n7GdNozBNJq2YxbUdw1nuaOfe/11+cvazz1JvCz9wB94YQXISPaeoQG8DqBlxypWqQR9lrUxVqn07wzgP24qCZReLQ== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=pass smtp.mailfrom=microsoft.com; dmarc=pass action=none header.from=microsoft.com; dkim=pass header.d=microsoft.com; arc=none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=selector2; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=ovuraEvPAyyeq9IvetDTrGvGbMWLADpiqBDCJzaJz08=; b=ZSM2t3PsVtl17NxYxAUJaucl1g7WzX06oy+AlQ5PkzZVR4t8NiaUygMrM1ZeIjig5NSHRW7y6UA4fNLATdwYDVROMZFoBs6pSP3rqIFaFry+RUDqyRNVqmGpWnpnq/ENi1jG97jxgC5w+6e6sVLddkLlGpt5P/9eV1da6h5e/AE= Received: from BL0PR2101MB1027.namprd21.prod.outlook.com (2603:10b6:207:30::33) by MN2PR21MB1390.namprd21.prod.outlook.com (2603:10b6:208:205::22) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.3045.9; Thu, 28 May 2020 00:47:02 +0000 Received: from BL0PR2101MB1027.namprd21.prod.outlook.com ([fe80::29cb:295d:97bc:3f7f]) by BL0PR2101MB1027.namprd21.prod.outlook.com ([fe80::29cb:295d:97bc:3f7f%9]) with mapi id 15.20.3066.007; Thu, 28 May 2020 00:47:02 +0000 From: Dave Thaler To: Timothy Mcsweeney , "uri-review@ietf.org" Thread-Topic: [Uri-review] Request for review Thread-Index: AQHWLXv2FOLhs6xYVEiA5gx7JqVPaaivKCm+gABmVgCAAPVnAIAA/yoAgABjToCAAr7PAIABtHOAgADZ/gCAACfJAIAAEHOAgAACgoCAACgmgIAAPVtggATYeoCAAArYoA== Date: Thu, 28 May 2020 00:47:02 +0000 Message-ID: References: <491516506.246380.1589851279474@email.ionos.com> <5EC9B257.31362.CC5E003@dan.tobias.name> <1783049000.100771.1590323508943@email.ionos.com> <5ECA8A94.23977.101292FE@dan.tobias.name> <1426881880.158099.1590335585858@email.ionos.com> <94368b41-c15b-da2c-421d-fdd9300be6e9@dret.net> <1310141163.159340.1590344745080@email.ionos.com> <1081815563.141711.1590624311343@email.ionos.com> In-Reply-To: <1081815563.141711.1590624311343@email.ionos.com> Accept-Language: en-US Content-Language: en-US X-MS-Has-Attach: X-MS-TNEF-Correlator: msip_labels: MSIP_Label_f42aa342-8706-4288-bd11-ebb85995028c_Enabled=true; MSIP_Label_f42aa342-8706-4288-bd11-ebb85995028c_SetDate=2020-05-28T00:47:00Z; MSIP_Label_f42aa342-8706-4288-bd11-ebb85995028c_Method=Standard; MSIP_Label_f42aa342-8706-4288-bd11-ebb85995028c_Name=Internal; MSIP_Label_f42aa342-8706-4288-bd11-ebb85995028c_SiteId=72f988bf-86f1-41af-91ab-2d7cd011db47; MSIP_Label_f42aa342-8706-4288-bd11-ebb85995028c_ActionId=c65ac381-2c1a-4cbe-bc53-c46841186d02; MSIP_Label_f42aa342-8706-4288-bd11-ebb85995028c_ContentBits=0 authentication-results: dropnumber.com; dkim=none (message not signed) header.d=none;dropnumber.com; dmarc=none action=none header.from=microsoft.com; x-originating-ip: [2601:600:9780:16f0:c096:d08c:8b1a:2063] x-ms-publictraffictype: Email x-ms-office365-filtering-ht: Tenant x-ms-office365-filtering-correlation-id: bd5cdf7d-d9a3-4017-5fee-08d802a0a2f8 x-ms-traffictypediagnostic: MN2PR21MB1390: x-microsoft-antispam-prvs: x-ms-oob-tlc-oobclassifiers: OLM:7219; x-forefront-prvs: 0417A3FFD2 x-ms-exchange-senderadcheck: 1 x-microsoft-antispam: BCL:0; x-microsoft-antispam-message-info: FVndqoVsf665P+qdQLhmDn/2RawgLuXlkjzGxx/rZApio6BiqtjCj9Tx9FRNt65v7J30P7cWNNNqw85WrPWoz2ejvLCGX5qWfDLNGfvKNAhEaFMYDqTnyI0Wi48R4I+bjR87ScGvoAK0UNL2LxpT4Ej0apodXNzlrX9ZJH1iEodds/GRM6G1OufZ+FXHD7CYC5PSya6oC/6MVaKC/lIB5YN2omSwT+LSlOWhzIZLCJgppa5J4gRG7S8aTjkd0Wu9ugJtkCS+rbh5AY9VpNXkVa29k5Eybq4gOMzeLyDAsJhfC1SERDhYrJyj7DvcwYhyQ9OboOS6TZr7lw/qTMyUtK66Ho2W28KVYCFDnnmEdhLx1e2PpuXTGX5sInV4Af/y4qNNbDbQ+DnMzb7LkQGf6A== x-forefront-antispam-report: CIP:255.255.255.255; CTRY:; LANG:en; SCL:1; SRV:; IPV:NLI; SFV:NSPM; H:BL0PR2101MB1027.namprd21.prod.outlook.com; PTR:; CAT:NONE; SFTY:; SFS:(4636009)(366004)(39860400002)(346002)(396003)(136003)(376002)(166002)(8676002)(53546011)(66556008)(6506007)(33656002)(10290500003)(8990500004)(66946007)(5660300002)(186003)(83380400001)(66476007)(76116006)(8936002)(66446008)(52536014)(478600001)(71200400001)(9686003)(64756008)(55016002)(86362001)(110136005)(2906002)(82950400001)(966005)(82960400001)(7696005)(316002); DIR:OUT; SFP:1102; x-ms-exchange-antispam-messagedata: wNTMwo8kPhZbSgDqLBfwQbuzxnyEGsa/UY4twQTZsIFYaUnvV02nD8en+9taNUwAOtKpsg4SpHlbm01vH/J5zJT8Ab1jQRY1B45glaMJlORRA055JU59ZJqG1x06UjMDG56zujwFszszFcsVfaaTCqL2MJ41wezCoaqmE2zmQegpbJPC3NbF6WEVfk+edOqMZyn3I1EBLq0ls1iAsS4gqXJeFPoXjUyCU3V5BKDJPNJLV9KclDxujnfPICyWvuIGweQAisY9VhgJiPsLuekq/8NEmbozc/PSOVjEjTLrLIAZQ5M119wyMHmwCmAPYiJ7TY7f9TiCvg8r3Rht3PlOCueYRbXrfW8QpVhY/thVhNWNlwcWxbapKiyG/Abp+9aYMIFV2lwsQv8V7GWefmtYkaFfT8NoeALzjIrp39T6yxhG8dT05UIz9OczVuOzYVHBSnFScdW5l/3wiYF6gxh/na5M3B8AKfHKGOVSzJ+RRlYSfEEBS4nO7VC5vWUARQh2McPs3MqLfXKn419FQeybz5aUFIaBaWy6SsyXSphTQ61SIIB36XjS3EfkYCniq5ng x-ms-exchange-transport-forked: True Content-Type: multipart/alternative; boundary="_000_BL0PR2101MB102762C4CAFACC383412D5D8A38E0BL0PR2101MB1027_" MIME-Version: 1.0 X-OriginatorOrg: microsoft.com X-MS-Exchange-CrossTenant-Network-Message-Id: bd5cdf7d-d9a3-4017-5fee-08d802a0a2f8 X-MS-Exchange-CrossTenant-originalarrivaltime: 28 May 2020 00:47:02.3535 (UTC) X-MS-Exchange-CrossTenant-fromentityheader: Hosted X-MS-Exchange-CrossTenant-id: 72f988bf-86f1-41af-91ab-2d7cd011db47 X-MS-Exchange-CrossTenant-mailboxtype: HOSTED X-MS-Exchange-CrossTenant-userprincipalname: chK/d3jfiC9Pd5st1RU4DItMa3PrXPG8PfWD8//qgJwJujKDVZ6qGN2gV5RX7wuWKP7cnFsZz0FSpsdWdeOC21tTCLC5M9/LyJPNVjeduzY= X-MS-Exchange-Transport-CrossTenantHeadersStamped: MN2PR21MB1390 Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 28 May 2020 00:47:07 -0000 --_000_BL0PR2101MB102762C4CAFACC383412D5D8A38E0BL0PR2101MB1027_ Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: base64 SSBkb27igJl0IHVuZGVyc3RhbmQgeW91ciBxdWVzdGlvbi4gICBUaGUgVVJMIHN5bnRheCBpcyBm aXhlZCBieSB0aGF0IFJGQy4NCkkgZG9u4oCZdCBrbm93IHdoYXQgeW91IG1lYW4gYnkg4oCcc2Fm ZeKAnSBvciDigJx2YWxpZOKAnS4NCg0KSWYgYnkg4oCcdmFsaWTigJ0geW91IG1lYW4g4oCcYWxs b3dlZCBieSBSRkMgMzk4NuKAnSwgdGhlIGFuc3dlciBpcyB0aGF0IHRoZXkgbWF5IG9ubHkgYXBw ZWFyIGluIGEgVVJMIGxpdGVyYWxseQ0KaWYgdGhleSBoYXZlIHRoZSBleGFjdCBtZWFuaW5nIGlu IHRoZSBSRkMsIG90aGVyd2lzZSB0aGV5IG11c3QgYmUgcGN0LWVuY29kZWQuDQoNCg0KRnJvbTog VXJpLXJldmlldyA8dXJpLXJldmlldy1ib3VuY2VzQGlldGYub3JnPiBPbiBCZWhhbGYgT2YgVGlt b3RoeSBNY3N3ZWVuZXkNClNlbnQ6IFdlZG5lc2RheSwgTWF5IDI3LCAyMDIwIDU6MDUgUE0NClRv OiB1cmktcmV2aWV3QGlldGYub3JnDQpTdWJqZWN0OiBSZTogW1VyaS1yZXZpZXddIFJlcXVlc3Qg Zm9yIHJldmlldw0KDQpIaSBEYXZlLA0KDQpJZiB0aGUgb3RoZXIgc2l4IGdlbi1kZWxpbXMgZnJv bSB0aGUgcmVzZXJ2ZWQgc2V0IHdlcmUgc2FmZSBhbmQgdmFsaWQsIHdvdWxkIHlvdSBvcHBvc2Ug dGhlaXIgdXNlIGluIFVSSXM/DQoNClRpbQ0KDQoNCg0KT24gTWF5IDI0LCAyMDIwIGF0IDY6MDgg UE0gRGF2ZSBUaGFsZXIgPGR0aGFsZXJAbWljcm9zb2Z0LmNvbTxtYWlsdG86ZHRoYWxlckBtaWNy b3NvZnQuY29tPj4gd3JvdGU6DQoNCkhpIFRpbSwNCg0KDQoNCkNvcnJlY3QgdGhlIGNvbG9uIGlz IG5vdCBwYXJ0IG9mIHRoZSBoaWVyLXBhcnQsIHRoZSBoaWVyLXBhcnQgaXMgd2hhdCBjb21lcyBh ZnRlciB0aGUgY29sb24uICBSRkMgMzk4NiBzYXlzOg0KDQoNCg0KVVJJICAgICAgICAgPSBzY2hl bWUgIjoiIGhpZXItcGFydCBbICI/IiBxdWVyeSBdIFsgIiMiIGZyYWdtZW50IF0NCg0KDQoNCk9u bHkgc3RyaW5ncyB0aGF0IGNvbmZvcm0gdG8gdGhlIGFib3ZlIGFyZSBVUklzLg0KDQpTbyDigJxk cm9wI3NkNTRnNTTigJ0gaXMgbm90IGEgVVJJIGJlY2F1c2UgaXQgZG9lcyBub3QgY29uZm9ybSB0 byB0aGUgYWJvdmUgc3ludGF4LCBhcyBpdCBoYXMgbm8g4oCcOuKAnQ0KDQoNCg0K4oCcZHJvcDpz ZDU0ZzU04oCdIG9uIHRoZSBvdGhlciBoYW5kIHdvdWxkIGJlIGEgdmFsaWQgVVJJLg0KDQoNCg0K VGhpcyBpcyB3aGF0IGZvbGtzIGFyZSBzYXlpbmcgd2hlbiB0aGV5IHNheSBpZiB5b3UganVzdCBj aGFuZ2UgdGhlIOKAnCPigJ0gdG8gYSDigJw64oCdIGluIHlvdXIgZHJhZnQgdGhlbiBpdCBiZWNv bWVzIGxlZ2FsLg0KDQoNCg0KRGF2ZQ0KDQoNCg0KRnJvbTogVXJpLXJldmlldyA8dXJpLXJldmll dy1ib3VuY2VzQGlldGYub3JnPG1haWx0bzp1cmktcmV2aWV3LWJvdW5jZXNAaWV0Zi5vcmc+PiBP biBCZWhhbGYgT2YgVGltb3RoeSBNY3N3ZWVuZXkNClNlbnQ6IFN1bmRheSwgTWF5IDI0LCAyMDIw IDExOjI2IEFNDQpUbzogRXJpayBXaWxkZSA8ZXJpay53aWxkZUBkcmV0Lm5ldDxtYWlsdG86ZXJp ay53aWxkZUBkcmV0Lm5ldD4+OyB1cmktcmV2aWV3QGlldGYub3JnPG1haWx0bzp1cmktcmV2aWV3 QGlldGYub3JnPg0KU3ViamVjdDogUmU6IFtVcmktcmV2aWV3XSBSZXF1ZXN0IGZvciByZXZpZXcN Cg0KDQoNCkhpIEVyaWssDQoNCg0KDQpUaGFuayB5b3UsIEkgd2lsbCBoYXZlIGFub3RoZXIgbG9v ayBhdCBteSByZWZlcmVuY2UgdG8gc2VjdGlvbiAzLg0KDQpXb3VsZCB5b3UgYWdyZWUgdGhhdCBp biAiaHR0cHM6Ly9pZXRmLm9yZzxodHRwczovL25hbTA2LnNhZmVsaW5rcy5wcm90ZWN0aW9uLm91 dGxvb2suY29tLz91cmw9aHR0cHMlM0ElMkYlMkZpZXRmLm9yZyUyRiZkYXRhPTAyJTdDMDElN0Nk dGhhbGVyJTQwbWljcm9zb2Z0LmNvbSU3QzQwN2VkZGFjZDkxNjRkZjhjMTkwMDhkODAyOWFjZmRj JTdDNzJmOTg4YmY4NmYxNDFhZjkxYWIyZDdjZDAxMWRiNDclN0MxJTdDMCU3QzYzNzI2MjIxMTIy ODczMjI3MiZzZGF0YT1oUmw0dHFwOGZRVGgzdm04b0txS0thVDQ2Z3BTTk1hcWxhYUhNUXl5TkN3 JTNEJnJlc2VydmVkPTA+IiB0aGUgY29sb24gaXMgbm90IHBhcnQgb2YgdGhlIGhpZXItcGFydD8N Cg0KT24gTWF5IDI0LCAyMDIwIGF0IDEyOjAyIFBNIEVyaWsgV2lsZGUgPCBlcmlrLndpbGRlQGRy ZXQubmV0PG1haWx0bzplcmlrLndpbGRlQGRyZXQubmV0Pj4gd3JvdGU6DQoNCg0KDQoNCg0KaGV5 IHRpbS4NCg0KDQoNCk9uIDIwMjAtMDUtMjQgMTc6NTMsIFRpbW90aHkgTWNzd2VlbmV5IHdyb3Rl Og0KDQpZZXMsIEkgYWdyZWUgYW5kIHVuZGVyc3RhbmQgdGhhdCB0aGUgc2FtZSB3YXkgYXMgeW91 LiAgIEJ1dCB3aGVuIHRoZSAiIyINCg0KbGVhdmVzIHRoZSBjbGllbnQgaXQgaXMgbm90IGxlYXZp bmcgYXMgYSBmcmFnbWVudCwNCg0Kd2hhdCBwZW9wbGUgYXJlIHRlbGxpbmcgeW91IGlzIHRoYXQg IiMiIGFuZCBhbnl0aGluZyBmb2xsb3dpbmcgaXQgbmV2ZXINCg0KbGVhdmVzIHRoZSBjbGllbnQs IGJ5IGRlZmluaXRpb24uLg0KDQoNCg0KaXQgaXMgbGVhdmluZyBhcyBhDQoNCndheSB0byBzZXBh cmF0ZSB0aGUgVVJJIGNvbXBvbmVudHMsIDxzY2hlbWU+IGFuZCA8cGF0aD4gb3IgZm9yIGh0dHAg aXQNCg0Kd291bGQgYmUgc2VwYXJhdGluZyA8c2NoZW1lPiBhbmQgPGF1dGhvcml0eT4uICBJdCBp cyB0aGlzIHRoYXQgbWFrZXMgbWUNCg0KYmVsaWV2ZSB0aGF0IGV2ZW4gaWYgdGhlIGNvbG9uIGlz IHJlcXVpcmVkIGZvciBodHRwIHJlc29sdXRpb24sIGl0IGlzDQoNCm5vdCBuZWNlc3NhcmlseSBy ZXF1aXJlZCBmb3IgYWxsIFVSSS4NCg0KdGhpcyBkaXNjdXNzaW9uIGNvdWxkIGJlIG1vcmUgcHJv ZHVjdGl2ZSBpZiB5b3UgaGFkIGEgYnJpZWYgbG9vayBhdCB0aGUNCg0Kc3BlY3MgeW91J3JlIGRl cGVuZGluZyBvbi4gdGhlIHZlcnkgZmlyc3QgcnVsZSBzaG93biBpbg0KDQpodHRwczovL3Rvb2xz LmlldGYub3JnL2h0bWwvcmZjMzk4NiNzZWN0aW9uLTM8aHR0cHM6Ly9uYW0wNi5zYWZlbGlua3Mu cHJvdGVjdGlvbi5vdXRsb29rLmNvbS8/dXJsPWh0dHBzJTNBJTJGJTJGdG9vbHMuaWV0Zi4ub3Jn JTJGaHRtbCUyRnJmYzM5ODYlMjNzZWN0aW9uLTMmZGF0YT0wMiU3QzAxJTdDZHRoYWxlciU0MG1p Y3Jvc29mdC5jb20lN0M0MDdlZGRhY2Q5MTY0ZGY4YzE5MDA4ZDgwMjlhY2ZkYyU3QzcyZjk4OGJm ODZmMTQxYWY5MWFiMmQ3Y2QwMTFkYjQ3JTdDMSU3QzAlN0M2MzcyNjIyMTEyMjg3NDIyNjYmc2Rh dGE9aDAlMkJhRGtpT1N6bDFoSEVZNHZqdm9ud3dIbTV3a2NJbVBNOHdJNlN6SVYwJTNEJnJlc2Vy dmVkPTA+IGlzDQoNCg0KDQpVUkkgPSBzY2hlbWUgIjoiIGhpZXItcGFydCBbICI/IiBxdWVyeSBd IFsgIiMiIGZyYWdtZW50IF0NCg0KDQoNCmVhY2ggVVJJIGlzIGRlZmluZWQgbGlrZSB0aGlzIGFu ZCBtdXN0IGhhdmUgYSBjb2xvbi4NCg0KDQoNCmNoZWVycywNCg0KDQoNCmRyZXQuDQoNCg0KDQot LQ0KDQplcmlrIHdpbGRlIHwgbWFpbHRvOiBlcmlrLndpbGRlQGRyZXQubmV0PG1haWx0bzplcmlr LndpbGRlQGRyZXQubmV0PiB8DQoNCnwgaHR0cDovL2RyZXQubmV0L25ldGRyZXQ8aHR0cHM6Ly9u YW0wNi5zYWZlbGlua3MucHJvdGVjdGlvbi5vdXRsb29rLmNvbS8/dXJsPWh0dHAlM0ElMkYlMkZk cmV0Lm5ldCUyRm5ldGRyZXQmZGF0YT0wMiU3QzAxJTdDZHRoYWxlciU0MG1pY3Jvc29mdC5jb20l N0M0MDdlZGRhY2Q5MTY0ZGY4YzE5MDA4ZDgwMjlhY2ZkYyU3QzcyZjk4OGJmODZmMTQxYWY5MWFi MmQ3Y2QwMTFkYjQ3JTdDMSU3QzAlN0M2MzcyNjIyMTEyMjg3NDIyNjYmc2RhdGE9eGprSmJlTlNS MElQTCUyRmJkJTJCM3FESnljbTlFUlJxa3pJUnZmVk9ndFd3WUUlM0QmcmVzZXJ2ZWQ9MD4gfA0K DQp8IGh0dHA6Ly90d2l0dGVyLmNvbS9kcmV0PGh0dHBzOi8vbmFtMDYuc2FmZWxpbmtzLnByb3Rl Y3Rpb24ub3V0bG9vay5jb20vP3VybD1odHRwJTNBJTJGJTJGdHdpdHRlci5jb20lMkZkcmV0JmRh dGE9MDIlN0MwMSU3Q2R0aGFsZXIlNDBtaWNyb3NvZnQuY29tJTdDNDA3ZWRkYWNkOTE2NGRmOGMx OTAwOGQ4MDI5YWNmZGMlN0M3MmY5ODhiZjg2ZjE0MWFmOTFhYjJkN2NkMDExZGI0NyU3QzElN0Mw JTdDNjM3MjYyMjExMjI4NzUyMjYwJnNkYXRhPSUyRlBuUW9BZW1Qb2dxekZ0WHI0bHZMN0V2VkJV TkhKS2tOT1Z2WmNmNUdrUSUzRCZyZXNlcnZlZD0wPiB8DQoNCg0K --_000_BL0PR2101MB102762C4CAFACC383412D5D8A38E0BL0PR2101MB1027_ Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: base64 PGh0bWwgeG1sbnM6dj0idXJuOnNjaGVtYXMtbWljcm9zb2Z0LWNvbTp2bWwiIHhtbG5zOm89InVy bjpzY2hlbWFzLW1pY3Jvc29mdC1jb206b2ZmaWNlOm9mZmljZSIgeG1sbnM6dz0idXJuOnNjaGVt YXMtbWljcm9zb2Z0LWNvbTpvZmZpY2U6d29yZCIgeG1sbnM6ZHQ9InV1aWQ6QzJGNDEwMTAtNjVC My0xMWQxLUEyOUYtMDBBQTAwQzE0ODgyIiB4bWxuczptPSJodHRwOi8vc2NoZW1hcy5taWNyb3Nv ZnQuY29tL29mZmljZS8yMDA0LzEyL29tbWwiIHhtbG5zPSJodHRwOi8vd3d3LnczLm9yZy9UUi9S RUMtaHRtbDQwIj4NCjxoZWFkPg0KPG1ldGEgaHR0cC1lcXVpdj0iQ29udGVudC1UeXBlIiBjb250 ZW50PSJ0ZXh0L2h0bWw7IGNoYXJzZXQ9dXRmLTgiPg0KPG1ldGEgbmFtZT0iR2VuZXJhdG9yIiBj b250ZW50PSJNaWNyb3NvZnQgV29yZCAxNSAoZmlsdGVyZWQgbWVkaXVtKSI+DQo8c3R5bGU+PCEt LQ0KLyogRm9udCBEZWZpbml0aW9ucyAqLw0KQGZvbnQtZmFjZQ0KCXtmb250LWZhbWlseToiQ2Ft YnJpYSBNYXRoIjsNCglwYW5vc2UtMToyIDQgNSAzIDUgNCA2IDMgMiA0O30NCkBmb250LWZhY2UN Cgl7Zm9udC1mYW1pbHk6Q2FsaWJyaTsNCglwYW5vc2UtMToyIDE1IDUgMiAyIDIgNCAzIDIgNDt9 DQovKiBTdHlsZSBEZWZpbml0aW9ucyAqLw0KcC5Nc29Ob3JtYWwsIGxpLk1zb05vcm1hbCwgZGl2 Lk1zb05vcm1hbA0KCXttYXJnaW46MGluOw0KCW1hcmdpbi1ib3R0b206LjAwMDFwdDsNCglmb250 LXNpemU6MTIuMHB0Ow0KCWZvbnQtZmFtaWx5OiJUaW1lcyBOZXcgUm9tYW4iLHNlcmlmO30NCmE6 bGluaywgc3Bhbi5Nc29IeXBlcmxpbmsNCgl7bXNvLXN0eWxlLXByaW9yaXR5Ojk5Ow0KCWNvbG9y OmJsdWU7DQoJdGV4dC1kZWNvcmF0aW9uOnVuZGVybGluZTt9DQphOnZpc2l0ZWQsIHNwYW4uTXNv SHlwZXJsaW5rRm9sbG93ZWQNCgl7bXNvLXN0eWxlLXByaW9yaXR5Ojk5Ow0KCWNvbG9yOnB1cnBs ZTsNCgl0ZXh0LWRlY29yYXRpb246dW5kZXJsaW5lO30NCnAubXNvbm9ybWFsMCwgbGkubXNvbm9y bWFsMCwgZGl2Lm1zb25vcm1hbDANCgl7bXNvLXN0eWxlLW5hbWU6bXNvbm9ybWFsOw0KCW1zby1t YXJnaW4tdG9wLWFsdDphdXRvOw0KCW1hcmdpbi1yaWdodDowaW47DQoJbXNvLW1hcmdpbi1ib3R0 b20tYWx0OmF1dG87DQoJbWFyZ2luLWxlZnQ6MGluOw0KCWZvbnQtc2l6ZToxMi4wcHQ7DQoJZm9u dC1mYW1pbHk6IlRpbWVzIE5ldyBSb21hbiIsc2VyaWY7fQ0KcC5veC00ZjZmN2FhZTc5LW1zb25v cm1hbCwgbGkub3gtNGY2ZjdhYWU3OS1tc29ub3JtYWwsIGRpdi5veC00ZjZmN2FhZTc5LW1zb25v cm1hbA0KCXttc28tc3R5bGUtbmFtZTpveC00ZjZmN2FhZTc5LW1zb25vcm1hbDsNCgltc28tbWFy Z2luLXRvcC1hbHQ6YXV0bzsNCgltYXJnaW4tcmlnaHQ6MGluOw0KCW1zby1tYXJnaW4tYm90dG9t LWFsdDphdXRvOw0KCW1hcmdpbi1sZWZ0OjBpbjsNCglmb250LXNpemU6MTIuMHB0Ow0KCWZvbnQt ZmFtaWx5OiJUaW1lcyBOZXcgUm9tYW4iLHNlcmlmO30NCnNwYW4uRW1haWxTdHlsZTIwDQoJe21z by1zdHlsZS10eXBlOnBlcnNvbmFsLXJlcGx5Ow0KCWZvbnQtZmFtaWx5OiJDYWxpYnJpIixzYW5z LXNlcmlmOw0KCWNvbG9yOiMxRjQ5N0Q7fQ0KLk1zb0NocERlZmF1bHQNCgl7bXNvLXN0eWxlLXR5 cGU6ZXhwb3J0LW9ubHk7DQoJZm9udC1zaXplOjEwLjBwdDt9DQpAcGFnZSBXb3JkU2VjdGlvbjEN Cgl7c2l6ZTo4LjVpbiAxMS4waW47DQoJbWFyZ2luOjEuMGluIDEuMGluIDEuMGluIDEuMGluO30N CmRpdi5Xb3JkU2VjdGlvbjENCgl7cGFnZTpXb3JkU2VjdGlvbjE7fQ0KLS0+PC9zdHlsZT48IS0t W2lmIGd0ZSBtc28gOV0+PHhtbD4NCjxvOnNoYXBlZGVmYXVsdHMgdjpleHQ9ImVkaXQiIHNwaWRt YXg9IjEwMjYiIC8+DQo8L3htbD48IVtlbmRpZl0tLT48IS0tW2lmIGd0ZSBtc28gOV0+PHhtbD4N CjxvOnNoYXBlbGF5b3V0IHY6ZXh0PSJlZGl0Ij4NCjxvOmlkbWFwIHY6ZXh0PSJlZGl0IiBkYXRh PSIxIiAvPg0KPC9vOnNoYXBlbGF5b3V0PjwveG1sPjwhW2VuZGlmXS0tPg0KPC9oZWFkPg0KPGJv ZHkgbGFuZz0iRU4tVVMiIGxpbms9ImJsdWUiIHZsaW5rPSJwdXJwbGUiPg0KPGRpdiBjbGFzcz0i V29yZFNlY3Rpb24xIj4NCjxwIGNsYXNzPSJNc29Ob3JtYWwiPjxzcGFuIHN0eWxlPSJmb250LXNp emU6MTEuMHB0O2ZvbnQtZmFtaWx5OiZxdW90O0NhbGlicmkmcXVvdDssc2Fucy1zZXJpZjtjb2xv cjojMUY0OTdEIj5JIGRvbuKAmXQgdW5kZXJzdGFuZCB5b3VyIHF1ZXN0aW9uLiZuYnNwOyZuYnNw OyBUaGUgVVJMIHN5bnRheCBpcyBmaXhlZCBieSB0aGF0IFJGQy48bzpwPjwvbzpwPjwvc3Bhbj48 L3A+DQo8cCBjbGFzcz0iTXNvTm9ybWFsIj48c3BhbiBzdHlsZT0iZm9udC1zaXplOjExLjBwdDtm b250LWZhbWlseTomcXVvdDtDYWxpYnJpJnF1b3Q7LHNhbnMtc2VyaWY7Y29sb3I6IzFGNDk3RCI+ SSBkb27igJl0IGtub3cgd2hhdCB5b3UgbWVhbiBieSDigJxzYWZl4oCdIG9yIOKAnHZhbGlk4oCd LjxvOnA+PC9vOnA+PC9zcGFuPjwvcD4NCjxwIGNsYXNzPSJNc29Ob3JtYWwiPjxzcGFuIHN0eWxl PSJmb250LXNpemU6MTEuMHB0O2ZvbnQtZmFtaWx5OiZxdW90O0NhbGlicmkmcXVvdDssc2Fucy1z ZXJpZjtjb2xvcjojMUY0OTdEIj48bzpwPiZuYnNwOzwvbzpwPjwvc3Bhbj48L3A+DQo8cCBjbGFz cz0iTXNvTm9ybWFsIj48c3BhbiBzdHlsZT0iZm9udC1zaXplOjExLjBwdDtmb250LWZhbWlseTom cXVvdDtDYWxpYnJpJnF1b3Q7LHNhbnMtc2VyaWY7Y29sb3I6IzFGNDk3RCI+SWYgYnkg4oCcdmFs aWTigJ0geW91IG1lYW4g4oCcYWxsb3dlZCBieSBSRkMgMzk4NuKAnSwgdGhlIGFuc3dlciBpcyB0 aGF0IHRoZXkgbWF5IG9ubHkgYXBwZWFyIGluIGEgVVJMIGxpdGVyYWxseTxvOnA+PC9vOnA+PC9z cGFuPjwvcD4NCjxwIGNsYXNzPSJNc29Ob3JtYWwiPjxzcGFuIHN0eWxlPSJmb250LXNpemU6MTEu MHB0O2ZvbnQtZmFtaWx5OiZxdW90O0NhbGlicmkmcXVvdDssc2Fucy1zZXJpZjtjb2xvcjojMUY0 OTdEIj5pZiB0aGV5IGhhdmUgdGhlIGV4YWN0IG1lYW5pbmcgaW4gdGhlIFJGQywgb3RoZXJ3aXNl IHRoZXkgbXVzdCBiZSBwY3QtZW5jb2RlZC48bzpwPjwvbzpwPjwvc3Bhbj48L3A+DQo8cCBjbGFz cz0iTXNvTm9ybWFsIj48c3BhbiBzdHlsZT0iZm9udC1zaXplOjExLjBwdDtmb250LWZhbWlseTom cXVvdDtDYWxpYnJpJnF1b3Q7LHNhbnMtc2VyaWY7Y29sb3I6IzFGNDk3RCI+PG86cD4mbmJzcDs8 L286cD48L3NwYW4+PC9wPg0KPHAgY2xhc3M9Ik1zb05vcm1hbCI+PHNwYW4gc3R5bGU9ImZvbnQt c2l6ZToxMS4wcHQ7Zm9udC1mYW1pbHk6JnF1b3Q7Q2FsaWJyaSZxdW90OyxzYW5zLXNlcmlmO2Nv bG9yOiMxRjQ5N0QiPjxvOnA+Jm5ic3A7PC9vOnA+PC9zcGFuPjwvcD4NCjxkaXY+DQo8ZGl2IHN0 eWxlPSJib3JkZXI6bm9uZTtib3JkZXItdG9wOnNvbGlkICNFMUUxRTEgMS4wcHQ7cGFkZGluZzoz LjBwdCAwaW4gMGluIDBpbiI+DQo8cCBjbGFzcz0iTXNvTm9ybWFsIj48Yj48c3BhbiBzdHlsZT0i Zm9udC1zaXplOjExLjBwdDtmb250LWZhbWlseTomcXVvdDtDYWxpYnJpJnF1b3Q7LHNhbnMtc2Vy aWYiPkZyb206PC9zcGFuPjwvYj48c3BhbiBzdHlsZT0iZm9udC1zaXplOjExLjBwdDtmb250LWZh bWlseTomcXVvdDtDYWxpYnJpJnF1b3Q7LHNhbnMtc2VyaWYiPiBVcmktcmV2aWV3ICZsdDt1cmkt cmV2aWV3LWJvdW5jZXNAaWV0Zi5vcmcmZ3Q7DQo8Yj5PbiBCZWhhbGYgT2YgPC9iPlRpbW90aHkg TWNzd2VlbmV5PGJyPg0KPGI+U2VudDo8L2I+IFdlZG5lc2RheSwgTWF5IDI3LCAyMDIwIDU6MDUg UE08YnI+DQo8Yj5Ubzo8L2I+IHVyaS1yZXZpZXdAaWV0Zi5vcmc8YnI+DQo8Yj5TdWJqZWN0Ojwv Yj4gUmU6IFtVcmktcmV2aWV3XSBSZXF1ZXN0IGZvciByZXZpZXc8bzpwPjwvbzpwPjwvc3Bhbj48 L3A+DQo8L2Rpdj4NCjwvZGl2Pg0KPHAgY2xhc3M9Ik1zb05vcm1hbCI+PG86cD4mbmJzcDs8L286 cD48L3A+DQo8ZGl2Pg0KPGRpdj4NCjxwIGNsYXNzPSJNc29Ob3JtYWwiPkhpIERhdmUsJm5ic3A7 IDxvOnA+PC9vOnA+PC9wPg0KPC9kaXY+DQo8cCBjbGFzcz0iTXNvTm9ybWFsIj48bzpwPiZuYnNw OzwvbzpwPjwvcD4NCjxkaXY+DQo8cCBjbGFzcz0iTXNvTm9ybWFsIj5JZiB0aGUgb3RoZXIgc2l4 IGdlbi1kZWxpbXMgZnJvbSB0aGUgcmVzZXJ2ZWQgc2V0IHdlcmUgc2FmZSBhbmQgdmFsaWQsIHdv dWxkIHlvdSBvcHBvc2UgdGhlaXIgdXNlIGluIFVSSXM/DQo8bzpwPjwvbzpwPjwvcD4NCjwvZGl2 Pg0KPHAgY2xhc3M9Ik1zb05vcm1hbCI+PG86cD4mbmJzcDs8L286cD48L3A+DQo8ZGl2Pg0KPHAg Y2xhc3M9Ik1zb05vcm1hbCI+VGltIDxvOnA+PC9vOnA+PC9wPg0KPC9kaXY+DQo8L2Rpdj4NCjxk aXY+DQo8cCBjbGFzcz0iTXNvTm9ybWFsIj48bzpwPiZuYnNwOzwvbzpwPjwvcD4NCjwvZGl2Pg0K PGRpdj4NCjxwIGNsYXNzPSJNc29Ob3JtYWwiPjxvOnA+Jm5ic3A7PC9vOnA+PC9wPg0KPC9kaXY+ DQo8ZGl2Pg0KPHAgY2xhc3M9Ik1zb05vcm1hbCI+PG86cD4mbmJzcDs8L286cD48L3A+DQo8L2Rp dj4NCjxibG9ja3F1b3RlIHN0eWxlPSJtYXJnaW4tdG9wOjUuMHB0O21hcmdpbi1ib3R0b206NS4w cHQiPg0KPHAgY2xhc3M9Ik1zb05vcm1hbCIgc3R5bGU9Im1hcmdpbi1ib3R0b206MTIuMHB0Ij5P biBNYXkgMjQsIDIwMjAgYXQgNjowOCBQTSBEYXZlIFRoYWxlciAmbHQ7PGEgaHJlZj0ibWFpbHRv OmR0aGFsZXJAbWljcm9zb2Z0LmNvbSI+ZHRoYWxlckBtaWNyb3NvZnQuY29tPC9hPiZndDsgd3Jv dGU6DQo8bzpwPjwvbzpwPjwvcD4NCjxkaXY+DQo8cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1tc29u b3JtYWwiPjxzcGFuIHN0eWxlPSJmb250LXNpemU6MTEuMHB0O2ZvbnQtZmFtaWx5OiZxdW90O0Nh bGlicmkmcXVvdDssc2Fucy1zZXJpZjtjb2xvcjojMUY0OTdEIj5IaSBUaW0sDQo8L3NwYW4+PG86 cD48L286cD48L3A+DQo8cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1tc29ub3JtYWwiPjxzcGFuIHN0 eWxlPSJmb250LXNpemU6MTEuMHB0O2ZvbnQtZmFtaWx5OiZxdW90O0NhbGlicmkmcXVvdDssc2Fu cy1zZXJpZjtjb2xvcjojMUY0OTdEIj4mbmJzcDsNCjwvc3Bhbj48bzpwPjwvbzpwPjwvcD4NCjxw IGNsYXNzPSJveC00ZjZmN2FhZTc5LW1zb25vcm1hbCI+PHNwYW4gc3R5bGU9ImZvbnQtc2l6ZTox MS4wcHQ7Zm9udC1mYW1pbHk6JnF1b3Q7Q2FsaWJyaSZxdW90OyxzYW5zLXNlcmlmO2NvbG9yOiMx RjQ5N0QiPkNvcnJlY3QgdGhlIGNvbG9uIGlzIG5vdCBwYXJ0IG9mIHRoZSBoaWVyLXBhcnQsIHRo ZSBoaWVyLXBhcnQgaXMgd2hhdCBjb21lcyBhZnRlciB0aGUgY29sb24uJm5ic3A7IFJGQyAzOTg2 IHNheXM6DQo8L3NwYW4+PG86cD48L286cD48L3A+DQo8cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1t c29ub3JtYWwiPjxzcGFuIHN0eWxlPSJmb250LXNpemU6MTEuMHB0O2ZvbnQtZmFtaWx5OiZxdW90 O0NhbGlicmkmcXVvdDssc2Fucy1zZXJpZjtjb2xvcjojMUY0OTdEIj4mbmJzcDsNCjwvc3Bhbj48 bzpwPjwvbzpwPjwvcD4NCjxwIGNsYXNzPSJveC00ZjZmN2FhZTc5LW1zb25vcm1hbCI+PHNwYW4g c3R5bGU9ImZvbnQtc2l6ZToxMC4wcHQ7Zm9udC1mYW1pbHk6JnF1b3Q7Q291cmllciBOZXcmcXVv dDs7Y29sb3I6YmxhY2siPlVSSSZuYnNwOyZuYnNwOyZuYnNwOyZuYnNwOyZuYnNwOyZuYnNwOyZu YnNwOyZuYnNwOyA9IHNjaGVtZSAmcXVvdDs6JnF1b3Q7IGhpZXItcGFydCBbICZxdW90Oz8mcXVv dDsgcXVlcnkgXSBbICZxdW90OyMmcXVvdDsgZnJhZ21lbnQgXQ0KPC9zcGFuPjxvOnA+PC9vOnA+ PC9wPg0KPHAgY2xhc3M9Im94LTRmNmY3YWFlNzktbXNvbm9ybWFsIj48c3BhbiBzdHlsZT0iZm9u dC1zaXplOjExLjBwdDtmb250LWZhbWlseTomcXVvdDtDYWxpYnJpJnF1b3Q7LHNhbnMtc2VyaWY7 Y29sb3I6IzFGNDk3RCI+Jm5ic3A7DQo8L3NwYW4+PG86cD48L286cD48L3A+DQo8cCBjbGFzcz0i b3gtNGY2ZjdhYWU3OS1tc29ub3JtYWwiPjxzcGFuIHN0eWxlPSJmb250LXNpemU6MTEuMHB0O2Zv bnQtZmFtaWx5OiZxdW90O0NhbGlicmkmcXVvdDssc2Fucy1zZXJpZjtjb2xvcjojMUY0OTdEIj5P bmx5IHN0cmluZ3MgdGhhdCBjb25mb3JtIHRvIHRoZSBhYm92ZSBhcmUgVVJJcy4NCjwvc3Bhbj48 bzpwPjwvbzpwPjwvcD4NCjxwIGNsYXNzPSJveC00ZjZmN2FhZTc5LW1zb25vcm1hbCI+PHNwYW4g c3R5bGU9ImZvbnQtc2l6ZToxMS4wcHQ7Zm9udC1mYW1pbHk6JnF1b3Q7Q2FsaWJyaSZxdW90Oyxz YW5zLXNlcmlmO2NvbG9yOiMxRjQ5N0QiPlNvIOKAnGRyb3Ajc2Q1NGc1NOKAnSBpcyBub3QgYSBV UkkgYmVjYXVzZSBpdCBkb2VzIG5vdCBjb25mb3JtIHRvIHRoZSBhYm92ZSBzeW50YXgsIGFzIGl0 IGhhcyBubyDigJw64oCdDQo8L3NwYW4+PG86cD48L286cD48L3A+DQo8cCBjbGFzcz0ib3gtNGY2 ZjdhYWU3OS1tc29ub3JtYWwiPjxzcGFuIHN0eWxlPSJmb250LXNpemU6MTEuMHB0O2ZvbnQtZmFt aWx5OiZxdW90O0NhbGlicmkmcXVvdDssc2Fucy1zZXJpZjtjb2xvcjojMUY0OTdEIj4mbmJzcDsN Cjwvc3Bhbj48bzpwPjwvbzpwPjwvcD4NCjxwIGNsYXNzPSJveC00ZjZmN2FhZTc5LW1zb25vcm1h bCI+PHNwYW4gc3R5bGU9ImZvbnQtc2l6ZToxMS4wcHQ7Zm9udC1mYW1pbHk6JnF1b3Q7Q2FsaWJy aSZxdW90OyxzYW5zLXNlcmlmO2NvbG9yOiMxRjQ5N0QiPuKAnGRyb3A6c2Q1NGc1NOKAnSBvbiB0 aGUgb3RoZXIgaGFuZCB3b3VsZCBiZSBhIHZhbGlkIFVSSS4NCjwvc3Bhbj48bzpwPjwvbzpwPjwv cD4NCjxwIGNsYXNzPSJveC00ZjZmN2FhZTc5LW1zb25vcm1hbCI+PHNwYW4gc3R5bGU9ImZvbnQt c2l6ZToxMS4wcHQ7Zm9udC1mYW1pbHk6JnF1b3Q7Q2FsaWJyaSZxdW90OyxzYW5zLXNlcmlmO2Nv bG9yOiMxRjQ5N0QiPiZuYnNwOw0KPC9zcGFuPjxvOnA+PC9vOnA+PC9wPg0KPHAgY2xhc3M9Im94 LTRmNmY3YWFlNzktbXNvbm9ybWFsIj48c3BhbiBzdHlsZT0iZm9udC1zaXplOjExLjBwdDtmb250 LWZhbWlseTomcXVvdDtDYWxpYnJpJnF1b3Q7LHNhbnMtc2VyaWY7Y29sb3I6IzFGNDk3RCI+VGhp cyBpcyB3aGF0IGZvbGtzIGFyZSBzYXlpbmcgd2hlbiB0aGV5IHNheSBpZiB5b3UganVzdCBjaGFu Z2UgdGhlIOKAnCPigJ0gdG8gYSDigJw64oCdIGluIHlvdXIgZHJhZnQgdGhlbiBpdCBiZWNvbWVz IGxlZ2FsLg0KPC9zcGFuPjxvOnA+PC9vOnA+PC9wPg0KPHAgY2xhc3M9Im94LTRmNmY3YWFlNzkt bXNvbm9ybWFsIj48c3BhbiBzdHlsZT0iZm9udC1zaXplOjExLjBwdDtmb250LWZhbWlseTomcXVv dDtDYWxpYnJpJnF1b3Q7LHNhbnMtc2VyaWY7Y29sb3I6IzFGNDk3RCI+Jm5ic3A7DQo8L3NwYW4+ PG86cD48L286cD48L3A+DQo8cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1tc29ub3JtYWwiPjxzcGFu IHN0eWxlPSJmb250LXNpemU6MTEuMHB0O2ZvbnQtZmFtaWx5OiZxdW90O0NhbGlicmkmcXVvdDss c2Fucy1zZXJpZjtjb2xvcjojMUY0OTdEIj5EYXZlDQo8L3NwYW4+PG86cD48L286cD48L3A+DQo8 cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1tc29ub3JtYWwiPjxzcGFuIHN0eWxlPSJmb250LXNpemU6 MTEuMHB0O2ZvbnQtZmFtaWx5OiZxdW90O0NhbGlicmkmcXVvdDssc2Fucy1zZXJpZjtjb2xvcjoj MUY0OTdEIj4mbmJzcDsNCjwvc3Bhbj48bzpwPjwvbzpwPjwvcD4NCjxkaXY+DQo8ZGl2IHN0eWxl PSJib3JkZXI6bm9uZTtib3JkZXItdG9wOnNvbGlkICNFMUUxRTEgMS4wcHQ7cGFkZGluZzozLjBw dCAwaW4gMGluIDBpbiI+DQo8cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1tc29ub3JtYWwiPjxzdHJv bmc+PHNwYW4gc3R5bGU9ImZvbnQtc2l6ZToxMS4wcHQ7Zm9udC1mYW1pbHk6JnF1b3Q7Q2FsaWJy aSZxdW90OyxzYW5zLXNlcmlmIj5Gcm9tOjwvc3Bhbj48L3N0cm9uZz48c3BhbiBzdHlsZT0iZm9u dC1zaXplOjExLjBwdDtmb250LWZhbWlseTomcXVvdDtDYWxpYnJpJnF1b3Q7LHNhbnMtc2VyaWYi PiBVcmktcmV2aWV3ICZsdDs8YSBocmVmPSJtYWlsdG86dXJpLXJldmlldy1ib3VuY2VzQGlldGYu b3JnIj51cmktcmV2aWV3LWJvdW5jZXNAaWV0Zi5vcmc8L2E+Jmd0Ow0KPHN0cm9uZz48c3BhbiBz dHlsZT0iZm9udC1mYW1pbHk6JnF1b3Q7Q2FsaWJyaSZxdW90OyxzYW5zLXNlcmlmIj5PbiBCZWhh bGYgT2YgPC9zcGFuPjwvc3Ryb25nPlRpbW90aHkgTWNzd2VlbmV5PGJyPg0KPHN0cm9uZz48c3Bh biBzdHlsZT0iZm9udC1mYW1pbHk6JnF1b3Q7Q2FsaWJyaSZxdW90OyxzYW5zLXNlcmlmIj5TZW50 Ojwvc3Bhbj48L3N0cm9uZz4gU3VuZGF5LCBNYXkgMjQsIDIwMjAgMTE6MjYgQU08YnI+DQo8c3Ry b25nPjxzcGFuIHN0eWxlPSJmb250LWZhbWlseTomcXVvdDtDYWxpYnJpJnF1b3Q7LHNhbnMtc2Vy aWYiPlRvOjwvc3Bhbj48L3N0cm9uZz4gRXJpayBXaWxkZSAmbHQ7PGEgaHJlZj0ibWFpbHRvOmVy aWsud2lsZGVAZHJldC5uZXQiPmVyaWsud2lsZGVAZHJldC5uZXQ8L2E+Jmd0OzsNCjxhIGhyZWY9 Im1haWx0bzp1cmktcmV2aWV3QGlldGYub3JnIj51cmktcmV2aWV3QGlldGYub3JnPC9hPjxicj4N CjxzdHJvbmc+PHNwYW4gc3R5bGU9ImZvbnQtZmFtaWx5OiZxdW90O0NhbGlicmkmcXVvdDssc2Fu cy1zZXJpZiI+U3ViamVjdDo8L3NwYW4+PC9zdHJvbmc+IFJlOiBbVXJpLXJldmlld10gUmVxdWVz dCBmb3IgcmV2aWV3DQo8L3NwYW4+PG86cD48L286cD48L3A+DQo8L2Rpdj4NCjwvZGl2Pg0KPHAg Y2xhc3M9Im94LTRmNmY3YWFlNzktbXNvbm9ybWFsIj48bzpwPiZuYnNwOzwvbzpwPjwvcD4NCjxk aXY+DQo8cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1tc29ub3JtYWwiPkhpIEVyaWssJm5ic3A7PG86 cD48L286cD48L3A+DQo8L2Rpdj4NCjxkaXY+DQo8cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1tc29u b3JtYWwiPjxvOnA+Jm5ic3A7PC9vOnA+PC9wPg0KPC9kaXY+DQo8ZGl2Pg0KPHAgY2xhc3M9Im94 LTRmNmY3YWFlNzktbXNvbm9ybWFsIj5UaGFuayB5b3UsIEkgd2lsbCBoYXZlIGFub3RoZXIgbG9v ayBhdCBteSByZWZlcmVuY2UgdG8gc2VjdGlvbiAzLiZuYnNwOyAmbmJzcDs8bzpwPjwvbzpwPjwv cD4NCjwvZGl2Pg0KPGRpdj4NCjxwIGNsYXNzPSJveC00ZjZmN2FhZTc5LW1zb25vcm1hbCI+V291 bGQgeW91IGFncmVlIHRoYXQgaW4gJnF1b3Q7PGEgaHJlZj0iaHR0cHM6Ly9uYW0wNi5zYWZlbGlu a3MucHJvdGVjdGlvbi5vdXRsb29rLmNvbS8/dXJsPWh0dHBzJTNBJTJGJTJGaWV0Zi5vcmclMkYm YW1wO2RhdGE9MDIlN0MwMSU3Q2R0aGFsZXIlNDBtaWNyb3NvZnQuY29tJTdDNDA3ZWRkYWNkOTE2 NGRmOGMxOTAwOGQ4MDI5YWNmZGMlN0M3MmY5ODhiZjg2ZjE0MWFmOTFhYjJkN2NkMDExZGI0NyU3 QzElN0MwJTdDNjM3MjYyMjExMjI4NzMyMjcyJmFtcDtzZGF0YT1oUmw0dHFwOGZRVGgzdm04b0tx S0thVDQ2Z3BTTk1hcWxhYUhNUXl5TkN3JTNEJmFtcDtyZXNlcnZlZD0wIj5odHRwczovL2lldGYu b3JnPC9hPiZxdW90Ow0KIHRoZSBjb2xvbiBpcyBub3QgcGFydCBvZiB0aGUgaGllci1wYXJ0PyZu YnNwOzxvOnA+PC9vOnA+PC9wPg0KPC9kaXY+DQo8YmxvY2txdW90ZSBzdHlsZT0ibWFyZ2luLXRv cDo1LjBwdDttYXJnaW4tYm90dG9tOjUuMHB0Ij4NCjxkaXY+DQo8cCBjbGFzcz0ib3gtNGY2Zjdh YWU3OS1tc29ub3JtYWwiPk9uIE1heSAyNCwgMjAyMCBhdCAxMjowMiBQTSBFcmlrIFdpbGRlICZs dDsgPGEgaHJlZj0ibWFpbHRvOmVyaWsud2lsZGVAZHJldC5uZXQiPg0KZXJpay53aWxkZUBkcmV0 Lm5ldDwvYT4mZ3Q7IHdyb3RlOjxvOnA+PC9vOnA+PC9wPg0KPC9kaXY+DQo8ZGl2Pg0KPHAgY2xh c3M9Im94LTRmNmY3YWFlNzktbXNvbm9ybWFsIj48bzpwPiZuYnNwOzwvbzpwPjwvcD4NCjwvZGl2 Pg0KPGRpdj4NCjxwIGNsYXNzPSJveC00ZjZmN2FhZTc5LW1zb25vcm1hbCI+PG86cD4mbmJzcDs8 L286cD48L3A+DQo8L2Rpdj4NCjxkaXY+DQo8cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1tc29ub3Jt YWwiPmhleSB0aW0uPG86cD48L286cD48L3A+DQo8L2Rpdj4NCjxkaXY+DQo8cCBjbGFzcz0ib3gt NGY2ZjdhYWU3OS1tc29ub3JtYWwiPjxvOnA+Jm5ic3A7PC9vOnA+PC9wPg0KPC9kaXY+DQo8ZGl2 Pg0KPHAgY2xhc3M9Im94LTRmNmY3YWFlNzktbXNvbm9ybWFsIj5PbiAyMDIwLTA1LTI0IDE3OjUz LCBUaW1vdGh5IE1jc3dlZW5leSB3cm90ZTo8bzpwPjwvbzpwPjwvcD4NCjwvZGl2Pg0KPGJsb2Nr cXVvdGUgc3R5bGU9Im1hcmdpbi10b3A6NS4wcHQ7bWFyZ2luLWJvdHRvbTo1LjBwdCI+DQo8ZGl2 Pg0KPHAgY2xhc3M9Im94LTRmNmY3YWFlNzktbXNvbm9ybWFsIj5ZZXMsIEkgYWdyZWUgYW5kIHVu ZGVyc3RhbmQgdGhhdCB0aGUgc2FtZSB3YXkgYXMgeW91LiZuYnNwOyAmbmJzcDtCdXQgd2hlbiB0 aGUgJnF1b3Q7IyZxdW90OzxvOnA+PC9vOnA+PC9wPg0KPC9kaXY+DQo8ZGl2Pg0KPHAgY2xhc3M9 Im94LTRmNmY3YWFlNzktbXNvbm9ybWFsIj5sZWF2ZXMgdGhlIGNsaWVudCBpdCBpcyBub3QgbGVh dmluZyBhcyBhIGZyYWdtZW50LDxvOnA+PC9vOnA+PC9wPg0KPC9kaXY+DQo8L2Jsb2NrcXVvdGU+ DQo8ZGl2Pg0KPHAgY2xhc3M9Im94LTRmNmY3YWFlNzktbXNvbm9ybWFsIj53aGF0IHBlb3BsZSBh cmUgdGVsbGluZyB5b3UgaXMgdGhhdCAmcXVvdDsjJnF1b3Q7IGFuZCBhbnl0aGluZyBmb2xsb3dp bmcgaXQgbmV2ZXI8bzpwPjwvbzpwPjwvcD4NCjwvZGl2Pg0KPGRpdj4NCjxwIGNsYXNzPSJveC00 ZjZmN2FhZTc5LW1zb25vcm1hbCI+bGVhdmVzIHRoZSBjbGllbnQsIGJ5IGRlZmluaXRpb24uLjxv OnA+PC9vOnA+PC9wPg0KPC9kaXY+DQo8ZGl2Pg0KPHAgY2xhc3M9Im94LTRmNmY3YWFlNzktbXNv bm9ybWFsIj48bzpwPiZuYnNwOzwvbzpwPjwvcD4NCjwvZGl2Pg0KPGJsb2NrcXVvdGUgc3R5bGU9 Im1hcmdpbi10b3A6NS4wcHQ7bWFyZ2luLWJvdHRvbTo1LjBwdCI+DQo8ZGl2Pg0KPHAgY2xhc3M9 Im94LTRmNmY3YWFlNzktbXNvbm9ybWFsIj5pdCBpcyBsZWF2aW5nIGFzIGE8bzpwPjwvbzpwPjwv cD4NCjwvZGl2Pg0KPGRpdj4NCjxwIGNsYXNzPSJveC00ZjZmN2FhZTc5LW1zb25vcm1hbCI+d2F5 IHRvIHNlcGFyYXRlIHRoZSBVUkkgY29tcG9uZW50cywgJmx0O3NjaGVtZSZndDsgYW5kICZsdDtw YXRoJmd0OyBvciBmb3IgaHR0cCBpdDxvOnA+PC9vOnA+PC9wPg0KPC9kaXY+DQo8ZGl2Pg0KPHAg Y2xhc3M9Im94LTRmNmY3YWFlNzktbXNvbm9ybWFsIj53b3VsZCBiZSBzZXBhcmF0aW5nICZsdDtz Y2hlbWUmZ3Q7IGFuZCAmbHQ7YXV0aG9yaXR5Jmd0Oy4mbmJzcDsgSXQgaXMgdGhpcyB0aGF0IG1h a2VzIG1lPG86cD48L286cD48L3A+DQo8L2Rpdj4NCjxkaXY+DQo8cCBjbGFzcz0ib3gtNGY2Zjdh YWU3OS1tc29ub3JtYWwiPmJlbGlldmUgdGhhdCBldmVuIGlmIHRoZSBjb2xvbiBpcyByZXF1aXJl ZCBmb3IgaHR0cCByZXNvbHV0aW9uLCBpdCBpczxvOnA+PC9vOnA+PC9wPg0KPC9kaXY+DQo8ZGl2 Pg0KPHAgY2xhc3M9Im94LTRmNmY3YWFlNzktbXNvbm9ybWFsIj5ub3QgbmVjZXNzYXJpbHkgcmVx dWlyZWQgZm9yIGFsbCBVUkkuPG86cD48L286cD48L3A+DQo8L2Rpdj4NCjwvYmxvY2txdW90ZT4N CjxkaXY+DQo8cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1tc29ub3JtYWwiPnRoaXMgZGlzY3Vzc2lv biBjb3VsZCBiZSBtb3JlIHByb2R1Y3RpdmUgaWYgeW91IGhhZCBhIGJyaWVmIGxvb2sgYXQgdGhl PG86cD48L286cD48L3A+DQo8L2Rpdj4NCjxkaXY+DQo8cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1t c29ub3JtYWwiPnNwZWNzIHlvdSdyZSBkZXBlbmRpbmcgb24uIHRoZSB2ZXJ5IGZpcnN0IHJ1bGUg c2hvd24gaW48bzpwPjwvbzpwPjwvcD4NCjwvZGl2Pg0KPGRpdj4NCjxwIGNsYXNzPSJveC00ZjZm N2FhZTc5LW1zb25vcm1hbCI+PGEgaHJlZj0iaHR0cHM6Ly9uYW0wNi5zYWZlbGlua3MucHJvdGVj dGlvbi5vdXRsb29rLmNvbS8/dXJsPWh0dHBzJTNBJTJGJTJGdG9vbHMuaWV0Zi4ub3JnJTJGaHRt bCUyRnJmYzM5ODYlMjNzZWN0aW9uLTMmYW1wO2RhdGE9MDIlN0MwMSU3Q2R0aGFsZXIlNDBtaWNy b3NvZnQuY29tJTdDNDA3ZWRkYWNkOTE2NGRmOGMxOTAwOGQ4MDI5YWNmZGMlN0M3MmY5ODhiZjg2 ZjE0MWFmOTFhYjJkN2NkMDExZGI0NyU3QzElN0MwJTdDNjM3MjYyMjExMjI4NzQyMjY2JmFtcDtz ZGF0YT1oMCUyQmFEa2lPU3psMWhIRVk0dmp2b253d0htNXdrY0ltUE04d0k2U3pJVjAlM0QmYW1w O3Jlc2VydmVkPTAiIHRhcmdldD0iX2JsYW5rIj5odHRwczovL3Rvb2xzLmlldGYub3JnL2h0bWwv cmZjMzk4NiNzZWN0aW9uLTM8L2E+DQogaXM8bzpwPjwvbzpwPjwvcD4NCjwvZGl2Pg0KPGRpdj4N CjxwIGNsYXNzPSJveC00ZjZmN2FhZTc5LW1zb25vcm1hbCI+PG86cD4mbmJzcDs8L286cD48L3A+ DQo8L2Rpdj4NCjxkaXY+DQo8cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1tc29ub3JtYWwiPlVSSSA9 IHNjaGVtZSAmcXVvdDs6JnF1b3Q7IGhpZXItcGFydCBbICZxdW90Oz8mcXVvdDsgcXVlcnkgXSBb ICZxdW90OyMmcXVvdDsgZnJhZ21lbnQgXTxvOnA+PC9vOnA+PC9wPg0KPC9kaXY+DQo8ZGl2Pg0K PHAgY2xhc3M9Im94LTRmNmY3YWFlNzktbXNvbm9ybWFsIj48bzpwPiZuYnNwOzwvbzpwPjwvcD4N CjwvZGl2Pg0KPGRpdj4NCjxwIGNsYXNzPSJveC00ZjZmN2FhZTc5LW1zb25vcm1hbCI+ZWFjaCBV UkkgaXMgZGVmaW5lZCBsaWtlIHRoaXMgYW5kIG11c3QgaGF2ZSBhIGNvbG9uLjxvOnA+PC9vOnA+ PC9wPg0KPC9kaXY+DQo8ZGl2Pg0KPHAgY2xhc3M9Im94LTRmNmY3YWFlNzktbXNvbm9ybWFsIj48 bzpwPiZuYnNwOzwvbzpwPjwvcD4NCjwvZGl2Pg0KPGRpdj4NCjxwIGNsYXNzPSJveC00ZjZmN2Fh ZTc5LW1zb25vcm1hbCI+Y2hlZXJzLDxvOnA+PC9vOnA+PC9wPg0KPC9kaXY+DQo8ZGl2Pg0KPHAg Y2xhc3M9Im94LTRmNmY3YWFlNzktbXNvbm9ybWFsIj48bzpwPiZuYnNwOzwvbzpwPjwvcD4NCjwv ZGl2Pg0KPGRpdj4NCjxwIGNsYXNzPSJveC00ZjZmN2FhZTc5LW1zb25vcm1hbCI+ZHJldC48bzpw PjwvbzpwPjwvcD4NCjwvZGl2Pg0KPGRpdj4NCjxwIGNsYXNzPSJveC00ZjZmN2FhZTc5LW1zb25v cm1hbCI+PG86cD4mbmJzcDs8L286cD48L3A+DQo8L2Rpdj4NCjxkaXY+DQo8cCBjbGFzcz0ib3gt NGY2ZjdhYWU3OS1tc29ub3JtYWwiPi0tPG86cD48L286cD48L3A+DQo8L2Rpdj4NCjxkaXY+DQo8 cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1tc29ub3JtYWwiPmVyaWsgd2lsZGUgfCBtYWlsdG86IDxh IGhyZWY9Im1haWx0bzplcmlrLndpbGRlQGRyZXQubmV0Ij4NCmVyaWsud2lsZGVAZHJldC5uZXQ8 L2E+IHw8bzpwPjwvbzpwPjwvcD4NCjwvZGl2Pg0KPGRpdj4NCjxwIGNsYXNzPSJveC00ZjZmN2Fh ZTc5LW1zb25vcm1hbCI+fCA8YSBocmVmPSJodHRwczovL25hbTA2LnNhZmVsaW5rcy5wcm90ZWN0 aW9uLm91dGxvb2suY29tLz91cmw9aHR0cCUzQSUyRiUyRmRyZXQubmV0JTJGbmV0ZHJldCZhbXA7 ZGF0YT0wMiU3QzAxJTdDZHRoYWxlciU0MG1pY3Jvc29mdC5jb20lN0M0MDdlZGRhY2Q5MTY0ZGY4 YzE5MDA4ZDgwMjlhY2ZkYyU3QzcyZjk4OGJmODZmMTQxYWY5MWFiMmQ3Y2QwMTFkYjQ3JTdDMSU3 QzAlN0M2MzcyNjIyMTEyMjg3NDIyNjYmYW1wO3NkYXRhPXhqa0piZU5TUjBJUEwlMkZiZCUyQjNx REp5Y205RVJScWt6SVJ2ZlZPZ3RXd1lFJTNEJmFtcDtyZXNlcnZlZD0wIiB0YXJnZXQ9Il9ibGFu ayI+DQpodHRwOi8vZHJldC5uZXQvbmV0ZHJldDwvYT4gfDxvOnA+PC9vOnA+PC9wPg0KPC9kaXY+ DQo8ZGl2Pg0KPHAgY2xhc3M9Im94LTRmNmY3YWFlNzktbXNvbm9ybWFsIj58IDxhIGhyZWY9Imh0 dHBzOi8vbmFtMDYuc2FmZWxpbmtzLnByb3RlY3Rpb24ub3V0bG9vay5jb20vP3VybD1odHRwJTNB JTJGJTJGdHdpdHRlci5jb20lMkZkcmV0JmFtcDtkYXRhPTAyJTdDMDElN0NkdGhhbGVyJTQwbWlj cm9zb2Z0LmNvbSU3QzQwN2VkZGFjZDkxNjRkZjhjMTkwMDhkODAyOWFjZmRjJTdDNzJmOTg4YmY4 NmYxNDFhZjkxYWIyZDdjZDAxMWRiNDclN0MxJTdDMCU3QzYzNzI2MjIxMTIyODc1MjI2MCZhbXA7 c2RhdGE9JTJGUG5Rb0FlbVBvZ3F6RnRYcjRsdkw3RXZWQlVOSEpLa05PVnZaY2Y1R2tRJTNEJmFt cDtyZXNlcnZlZD0wIiB0YXJnZXQ9Il9ibGFuayI+DQpodHRwOi8vdHdpdHRlci5jb20vZHJldDwv YT4gfDxvOnA+PC9vOnA+PC9wPg0KPC9kaXY+DQo8L2Jsb2NrcXVvdGU+DQo8L2Rpdj4NCjwvYmxv Y2txdW90ZT4NCjxkaXY+DQo8cCBjbGFzcz0iTXNvTm9ybWFsIj48YnI+DQombmJzcDsgPG86cD48 L286cD48L3A+DQo8L2Rpdj4NCjwvZGl2Pg0KPC9ib2R5Pg0KPC9odG1sPg0K --_000_BL0PR2101MB102762C4CAFACC383412D5D8A38E0BL0PR2101MB1027_-- From nobody Wed May 27 17:48:20 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 444F33A00D4 for ; Wed, 27 May 2020 17:48:16 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -2.001 X-Spam-Level: X-Spam-Status: No, score=-2.001 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, DKIMWL_WL_HIGH=-0.001, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, DKIM_VALID_EF=-0.1, HTML_MESSAGE=0.001, HTTPS_HTTP_MISMATCH=0.1, RCVD_IN_MSPIKE_H2=-0.001, SPF_PASS=-0.001, URIBL_BLOCKED=0.001] autolearn=unavailable autolearn_force=no Authentication-Results: ietfa.amsl.com (amavisd-new); dkim=pass (1024-bit key) header.d=microsoft.com Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id JCpeQ626iq2L for ; Wed, 27 May 2020 17:48:14 -0700 (PDT) Received: from NAM12-BN8-obe.outbound.protection.outlook.com (mail-bn8nam12on2123.outbound.protection.outlook.com [40.107.237.123]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 39ED83A00D3 for ; Wed, 27 May 2020 17:48:14 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=dMymnrvNpw3HK4Vv5/XC7L9R9Q8G+FJVxJ44UbTevWqtl4kUwfuMDJn3AkDi6JmPgk5LmWWqpXSW0QcruOB/CG1AcrMdA6Z2iHLMQHcvayJToAm0YiYThAl8E3wKbqm8Ta7cKFAMnT/tLNt1PtS8kczZyYNjxR9VWWgdpp9jxrCugxiM+ZEapkn5Yih9Y1Ok/758r+VZy5vjXNvPbIdhMMSXyrMW/pI7iCM+dNoVGLnylw7qIhjoIPHEDjQD4/lJdgvdRzqU1+kMSgkICkWnGDU/UZ8ANde6MC2Jhh+VFHaRwstztnq2ZX1Zgdq3AcjU1yepf7CMnhGa4Dl/Op0REg== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=XuMbtwUrz1FYcNHSQApbPihPkMEFVWmfUSJ8M211iU8=; b=A7ro3g46JQ4f3KrDZFSChClC3HLec3X0iFnzIpNEW2oPL9mX1elry6/myPcMAbY/3hM4CxyEPOB0DNTJOJwhSBgTcNu6c2sqqx69HAk/dylQYSYfHOoe6uoqsnCet3iHqIcXXyb2yDpqfbc+b/dDa936HuSLZTgsTgkMro/Vrzd0ggHADJdbM8sWA8nwBS5h08CvaKnXCvAwHszUZrpFM7vgoQRXsfXvd4NpXkghE7YYf/Ea2tQFT9QFWJCd4CT8ac0NNBXh8C+ahoiUmZtp8klw/+X6reAE+miFA5RJbuileO26YzgY7ZwspTZzMyRSjr9f50i5oZ5Copaqx/+dYw== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=pass smtp.mailfrom=microsoft.com; dmarc=pass action=none header.from=microsoft.com; dkim=pass header.d=microsoft.com; arc=none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=selector2; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=XuMbtwUrz1FYcNHSQApbPihPkMEFVWmfUSJ8M211iU8=; b=AdHZ3eUpj7Z404XDdmydbuIGiIe4AN6hz8+sKpGK+8TBUmYNCwWlQUl10VQCIfZKrdaAnj3iJKL0NrJgHY8t8Za1eORWm9Fj3A1yG5igSZ1heqbnO+XKRJL7EXE/L+E4rHqmDphjwfC2HV2zXQl/KD1T8yBwRcbpzWYhPswp6zw= Received: from BL0PR2101MB1027.namprd21.prod.outlook.com (2603:10b6:207:30::33) by MN2PR21MB1390.namprd21.prod.outlook.com (2603:10b6:208:205::22) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.3045.9; Thu, 28 May 2020 00:48:12 +0000 Received: from BL0PR2101MB1027.namprd21.prod.outlook.com ([fe80::29cb:295d:97bc:3f7f]) by BL0PR2101MB1027.namprd21.prod.outlook.com ([fe80::29cb:295d:97bc:3f7f%9]) with mapi id 15.20.3066.007; Thu, 28 May 2020 00:48:12 +0000 From: Dave Thaler To: Dave Thaler , Timothy Mcsweeney , "uri-review@ietf.org" Thread-Topic: [Uri-review] Request for review Thread-Index: AQHWLXv2FOLhs6xYVEiA5gx7JqVPaaivKCm+gABmVgCAAPVnAIAA/yoAgABjToCAAr7PAIABtHOAgADZ/gCAACfJAIAAEHOAgAACgoCAACgmgIAAPVtggATYeoCAAArYoIAAARhA Date: Thu, 28 May 2020 00:48:12 +0000 Message-ID: References: <491516506.246380.1589851279474@email.ionos.com> <5EC9B257.31362.CC5E003@dan.tobias.name> <1783049000.100771.1590323508943@email.ionos.com> <5ECA8A94.23977.101292FE@dan.tobias.name> <1426881880.158099.1590335585858@email.ionos.com> <94368b41-c15b-da2c-421d-fdd9300be6e9@dret.net> <1310141163.159340.1590344745080@email.ionos.com> <1081815563.141711.1590624311343@email.ionos.com> In-Reply-To: Accept-Language: en-US Content-Language: en-US X-MS-Has-Attach: X-MS-TNEF-Correlator: msip_labels: MSIP_Label_f42aa342-8706-4288-bd11-ebb85995028c_Enabled=true; MSIP_Label_f42aa342-8706-4288-bd11-ebb85995028c_SetDate=2020-05-28T00:47:00Z; MSIP_Label_f42aa342-8706-4288-bd11-ebb85995028c_Method=Standard; MSIP_Label_f42aa342-8706-4288-bd11-ebb85995028c_Name=Internal; MSIP_Label_f42aa342-8706-4288-bd11-ebb85995028c_SiteId=72f988bf-86f1-41af-91ab-2d7cd011db47; MSIP_Label_f42aa342-8706-4288-bd11-ebb85995028c_ActionId=c65ac381-2c1a-4cbe-bc53-c46841186d02; MSIP_Label_f42aa342-8706-4288-bd11-ebb85995028c_ContentBits=0 authentication-results: dmarc.ietf.org; dkim=none (message not signed) header.d=none;dmarc.ietf.org; dmarc=none action=none header.from=microsoft.com; x-originating-ip: [2601:600:9780:16f0:c096:d08c:8b1a:2063] x-ms-publictraffictype: Email x-ms-office365-filtering-ht: Tenant x-ms-office365-filtering-correlation-id: db85600a-6d32-47a7-b0fc-08d802a0ccbb x-ms-traffictypediagnostic: MN2PR21MB1390: x-microsoft-antispam-prvs: x-ms-oob-tlc-oobclassifiers: OLM:7219; x-forefront-prvs: 0417A3FFD2 x-ms-exchange-senderadcheck: 1 x-microsoft-antispam: BCL:0; x-microsoft-antispam-message-info: gADhtiIeOrAEhAtE4ZmNGv166Uj3oAITF7LsJSS5fKFjBj8L7+YyLOpeRqzCHwatFxOYnb8enRlKElCLfy2liapASd4qCM0NJc9TuRNkopLVUprcvq7gUfgmRrUybBDIsCGQhEHtRIv7H8ng7QW6msgiIwOIO1159yBMDZnWngFjp3Kn2bAdls0bAz8TjKYuWnB0ZG9BpJaNUxGMLptLPOuXs/U1cmPsjDSVeBimFrrK6jUi1Ril3c5ok1NbRtOcEBuRX4gV566LgtQO4hDNnAuX2idNuZXVBrt3WYysJyUhfNeTag+rkhF99YrzJ2e8bsby29TLyFnQCek6cGmpVlkNmiJo5LzIFb9Ovry0s/5c7dvBAaJ2C7TB22sYWKM50+f3mEjNJMGEx0BcDY6CPQ== x-forefront-antispam-report: CIP:255.255.255.255; CTRY:; LANG:en; SCL:1; SRV:; IPV:NLI; SFV:NSPM; H:BL0PR2101MB1027.namprd21.prod.outlook.com; PTR:; CAT:NONE; SFTY:; SFS:(4636009)(366004)(39860400002)(346002)(396003)(136003)(376002)(166002)(8676002)(53546011)(2940100002)(66556008)(6506007)(33656002)(10290500003)(8990500004)(66946007)(5660300002)(186003)(83380400001)(66476007)(76116006)(8936002)(66446008)(52536014)(478600001)(71200400001)(9686003)(64756008)(55016002)(86362001)(110136005)(2906002)(82950400001)(966005)(82960400001)(7696005)(316002); DIR:OUT; SFP:1102; x-ms-exchange-antispam-messagedata: y0xEaEjQgDu0vy5/3LH0h7UZo4yg5SK0p79YG/QY6jh+2Lx3O7JGdMdt0rN2Y7QySRQS0rk7ciuz25ZJDX4D0GVPDiSggqEfoJ0He64q+UcDiG860l0pAMFfAIaLPRjjjPRMXEwyadFR6xUgrZ2y5fyWVjZn6NJZdWQJisiPwXSYcPzdX9fpwDp36zwppKiJ7InQznXJt+lWPVdEeHDvUGfL+50JKcTKqpe1PRV4UIrs0q1u7TnrQZvjHWoVKrBCIzSUhQIIYU+68tZUifrF8mqk2b4BKVm/+SXgHmp4v7p4wA72/xL881KriiRlZWPPWaWrb+zT2mXddhkb+KSilwye5eZfeW7nVIO4MapPcsO1KhO6+PPGI8BJT9Y7CW2OU6LJOQIbLva+kXKqkM+F2eM3hnHYnjrejEVVyX7VAdCkJ/37RaCH8PVZD6+T8I3wCQYef1SATlW3V+TVMAwOniOnu6VcGCzPVy4D3nqwhS8jMuZLwp9La1+/y9Rm7ppao5Lmwf3meVP97pC6F+nhqvbMgcudSoZD0hajsxDy0y745gC+ut5Cx49EopiT+Aqc x-ms-exchange-transport-forked: True Content-Type: multipart/alternative; boundary="_000_BL0PR2101MB10278A5360398EFF2E73FC0BA38E0BL0PR2101MB1027_" MIME-Version: 1.0 X-OriginatorOrg: microsoft.com X-MS-Exchange-CrossTenant-Network-Message-Id: db85600a-6d32-47a7-b0fc-08d802a0ccbb X-MS-Exchange-CrossTenant-originalarrivaltime: 28 May 2020 00:48:12.4651 (UTC) X-MS-Exchange-CrossTenant-fromentityheader: Hosted X-MS-Exchange-CrossTenant-id: 72f988bf-86f1-41af-91ab-2d7cd011db47 X-MS-Exchange-CrossTenant-mailboxtype: HOSTED X-MS-Exchange-CrossTenant-userprincipalname: p3C/oLQ9eI8P/tVm6ozBXQjYxx111txFXoKI/hPotH8rXlIh4Jebf4tJMkzAtcLOJ49I9/VUax/wykblZh659N3jYCHc/aN1TrPHjUeEvKY= X-MS-Exchange-Transport-CrossTenantHeadersStamped: MN2PR21MB1390 Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 28 May 2020 00:48:16 -0000 --_000_BL0PR2101MB10278A5360398EFF2E73FC0BA38E0BL0PR2101MB1027_ Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: base64 cy9VUkwvVVJJLyBpbiBib3RoIGNhc2VzIGluIG15IHJlc3BvbnNlIOKYug0KDQpGcm9tOiBVcmkt cmV2aWV3IDx1cmktcmV2aWV3LWJvdW5jZXNAaWV0Zi5vcmc+IE9uIEJlaGFsZiBPZiBEYXZlIFRo YWxlcg0KU2VudDogV2VkbmVzZGF5LCBNYXkgMjcsIDIwMjAgNTo0NyBQTQ0KVG86IFRpbW90aHkg TWNzd2VlbmV5IDx0aW1AZHJvcG51bWJlci5jb20+OyB1cmktcmV2aWV3QGlldGYub3JnDQpTdWJq ZWN0OiBSZTogW1VyaS1yZXZpZXddIFJlcXVlc3QgZm9yIHJldmlldw0KDQpJIGRvbuKAmXQgdW5k ZXJzdGFuZCB5b3VyIHF1ZXN0aW9uLiAgIFRoZSBVUkwgc3ludGF4IGlzIGZpeGVkIGJ5IHRoYXQg UkZDLg0KSSBkb27igJl0IGtub3cgd2hhdCB5b3UgbWVhbiBieSDigJxzYWZl4oCdIG9yIOKAnHZh bGlk4oCdLg0KDQpJZiBieSDigJx2YWxpZOKAnSB5b3UgbWVhbiDigJxhbGxvd2VkIGJ5IFJGQyAz OTg24oCdLCB0aGUgYW5zd2VyIGlzIHRoYXQgdGhleSBtYXkgb25seSBhcHBlYXIgaW4gYSBVUkwg bGl0ZXJhbGx5DQppZiB0aGV5IGhhdmUgdGhlIGV4YWN0IG1lYW5pbmcgaW4gdGhlIFJGQywgb3Ro ZXJ3aXNlIHRoZXkgbXVzdCBiZSBwY3QtZW5jb2RlZC4NCg0KDQpGcm9tOiBVcmktcmV2aWV3IDx1 cmktcmV2aWV3LWJvdW5jZXNAaWV0Zi5vcmc8bWFpbHRvOnVyaS1yZXZpZXctYm91bmNlc0BpZXRm Lm9yZz4+IE9uIEJlaGFsZiBPZiBUaW1vdGh5IE1jc3dlZW5leQ0KU2VudDogV2VkbmVzZGF5LCBN YXkgMjcsIDIwMjAgNTowNSBQTQ0KVG86IHVyaS1yZXZpZXdAaWV0Zi5vcmc8bWFpbHRvOnVyaS1y ZXZpZXdAaWV0Zi5vcmc+DQpTdWJqZWN0OiBSZTogW1VyaS1yZXZpZXddIFJlcXVlc3QgZm9yIHJl dmlldw0KDQpIaSBEYXZlLA0KDQpJZiB0aGUgb3RoZXIgc2l4IGdlbi1kZWxpbXMgZnJvbSB0aGUg cmVzZXJ2ZWQgc2V0IHdlcmUgc2FmZSBhbmQgdmFsaWQsIHdvdWxkIHlvdSBvcHBvc2UgdGhlaXIg dXNlIGluIFVSSXM/DQoNClRpbQ0KDQoNCg0KT24gTWF5IDI0LCAyMDIwIGF0IDY6MDggUE0gRGF2 ZSBUaGFsZXIgPGR0aGFsZXJAbWljcm9zb2Z0LmNvbTxtYWlsdG86ZHRoYWxlckBtaWNyb3NvZnQu Y29tPj4gd3JvdGU6DQoNCkhpIFRpbSwNCg0KDQoNCkNvcnJlY3QgdGhlIGNvbG9uIGlzIG5vdCBw YXJ0IG9mIHRoZSBoaWVyLXBhcnQsIHRoZSBoaWVyLXBhcnQgaXMgd2hhdCBjb21lcyBhZnRlciB0 aGUgY29sb24uICBSRkMgMzk4NiBzYXlzOg0KDQoNCg0KVVJJICAgICAgICAgPSBzY2hlbWUgIjoi IGhpZXItcGFydCBbICI/IiBxdWVyeSBdIFsgIiMiIGZyYWdtZW50IF0NCg0KDQoNCk9ubHkgc3Ry aW5ncyB0aGF0IGNvbmZvcm0gdG8gdGhlIGFib3ZlIGFyZSBVUklzLg0KDQpTbyDigJxkcm9wI3Nk NTRnNTTigJ0gaXMgbm90IGEgVVJJIGJlY2F1c2UgaXQgZG9lcyBub3QgY29uZm9ybSB0byB0aGUg YWJvdmUgc3ludGF4LCBhcyBpdCBoYXMgbm8g4oCcOuKAnQ0KDQoNCg0K4oCcZHJvcDpzZDU0ZzU0 4oCdIG9uIHRoZSBvdGhlciBoYW5kIHdvdWxkIGJlIGEgdmFsaWQgVVJJLg0KDQoNCg0KVGhpcyBp cyB3aGF0IGZvbGtzIGFyZSBzYXlpbmcgd2hlbiB0aGV5IHNheSBpZiB5b3UganVzdCBjaGFuZ2Ug dGhlIOKAnCPigJ0gdG8gYSDigJw64oCdIGluIHlvdXIgZHJhZnQgdGhlbiBpdCBiZWNvbWVzIGxl Z2FsLg0KDQoNCg0KRGF2ZQ0KDQoNCg0KRnJvbTogVXJpLXJldmlldyA8dXJpLXJldmlldy1ib3Vu Y2VzQGlldGYub3JnPG1haWx0bzp1cmktcmV2aWV3LWJvdW5jZXNAaWV0Zi5vcmc+PiBPbiBCZWhh bGYgT2YgVGltb3RoeSBNY3N3ZWVuZXkNClNlbnQ6IFN1bmRheSwgTWF5IDI0LCAyMDIwIDExOjI2 IEFNDQpUbzogRXJpayBXaWxkZSA8ZXJpay53aWxkZUBkcmV0Lm5ldDxtYWlsdG86ZXJpay53aWxk ZUBkcmV0Lm5ldD4+OyB1cmktcmV2aWV3QGlldGYub3JnPG1haWx0bzp1cmktcmV2aWV3QGlldGYu b3JnPg0KU3ViamVjdDogUmU6IFtVcmktcmV2aWV3XSBSZXF1ZXN0IGZvciByZXZpZXcNCg0KDQoN CkhpIEVyaWssDQoNCg0KDQpUaGFuayB5b3UsIEkgd2lsbCBoYXZlIGFub3RoZXIgbG9vayBhdCBt eSByZWZlcmVuY2UgdG8gc2VjdGlvbiAzLg0KDQpXb3VsZCB5b3UgYWdyZWUgdGhhdCBpbiAiaHR0 cHM6Ly9pZXRmLm9yZzxodHRwczovL25hbTA2LnNhZmVsaW5rcy5wcm90ZWN0aW9uLm91dGxvb2su Y29tLz91cmw9aHR0cHMlM0ElMkYlMkZpZXRmLm9yZyUyRiZkYXRhPTAyJTdDMDElN0NkdGhhbGVy JTQwbWljcm9zb2Z0LmNvbSU3Q2IxMTVjN2Y4YzcwYjQxMGViOTgzMDhkODAyYTBhOGY0JTdDNzJm OTg4YmY4NmYxNDFhZjkxYWIyZDdjZDAxMWRiNDclN0MxJTdDMCU3QzYzNzI2MjIzNjMzOTIwNDE5 MiZzZGF0YT1VSjdUUW5LZkdaTW5Xa0JLWkNWb3paUWhuJTJCR2lyMXNhaVBRb05HVjJDOU0lM0Qm cmVzZXJ2ZWQ9MD4iIHRoZSBjb2xvbiBpcyBub3QgcGFydCBvZiB0aGUgaGllci1wYXJ0Pw0KDQpP biBNYXkgMjQsIDIwMjAgYXQgMTI6MDIgUE0gRXJpayBXaWxkZSA8IGVyaWsud2lsZGVAZHJldC5u ZXQ8bWFpbHRvOmVyaWsud2lsZGVAZHJldC5uZXQ+PiB3cm90ZToNCg0KDQoNCg0KDQpoZXkgdGlt Lg0KDQoNCg0KT24gMjAyMC0wNS0yNCAxNzo1MywgVGltb3RoeSBNY3N3ZWVuZXkgd3JvdGU6DQoN ClllcywgSSBhZ3JlZSBhbmQgdW5kZXJzdGFuZCB0aGF0IHRoZSBzYW1lIHdheSBhcyB5b3UuICAg QnV0IHdoZW4gdGhlICIjIg0KDQpsZWF2ZXMgdGhlIGNsaWVudCBpdCBpcyBub3QgbGVhdmluZyBh cyBhIGZyYWdtZW50LA0KDQp3aGF0IHBlb3BsZSBhcmUgdGVsbGluZyB5b3UgaXMgdGhhdCAiIyIg YW5kIGFueXRoaW5nIGZvbGxvd2luZyBpdCBuZXZlcg0KDQpsZWF2ZXMgdGhlIGNsaWVudCwgYnkg ZGVmaW5pdGlvbi4uDQoNCg0KDQppdCBpcyBsZWF2aW5nIGFzIGENCg0Kd2F5IHRvIHNlcGFyYXRl IHRoZSBVUkkgY29tcG9uZW50cywgPHNjaGVtZT4gYW5kIDxwYXRoPiBvciBmb3IgaHR0cCBpdA0K DQp3b3VsZCBiZSBzZXBhcmF0aW5nIDxzY2hlbWU+IGFuZCA8YXV0aG9yaXR5Pi4gIEl0IGlzIHRo aXMgdGhhdCBtYWtlcyBtZQ0KDQpiZWxpZXZlIHRoYXQgZXZlbiBpZiB0aGUgY29sb24gaXMgcmVx dWlyZWQgZm9yIGh0dHAgcmVzb2x1dGlvbiwgaXQgaXMNCg0Kbm90IG5lY2Vzc2FyaWx5IHJlcXVp cmVkIGZvciBhbGwgVVJJLg0KDQp0aGlzIGRpc2N1c3Npb24gY291bGQgYmUgbW9yZSBwcm9kdWN0 aXZlIGlmIHlvdSBoYWQgYSBicmllZiBsb29rIGF0IHRoZQ0KDQpzcGVjcyB5b3UncmUgZGVwZW5k aW5nIG9uLiB0aGUgdmVyeSBmaXJzdCBydWxlIHNob3duIGluDQoNCmh0dHBzOi8vdG9vbHMuaWV0 Zi5vcmcvaHRtbC9yZmMzOTg2I3NlY3Rpb24tMzxodHRwczovL25hbTA2LnNhZmVsaW5rcy5wcm90 ZWN0aW9uLm91dGxvb2suY29tLz91cmw9aHR0cHMlM0ElMkYlMkZ0b29scy5pZXRmLi5vcmclMkZo dG1sJTJGcmZjMzk4NiUyM3NlY3Rpb24tMyZkYXRhPTAyJTdDMDElN0NkdGhhbGVyJTQwbWljcm9z b2Z0LmNvbSU3Q2IxMTVjN2Y4YzcwYjQxMGViOTgzMDhkODAyYTBhOGY0JTdDNzJmOTg4YmY4NmYx NDFhZjkxYWIyZDdjZDAxMWRiNDclN0MxJTdDMCU3QzYzNzI2MjIzNjMzOTIxNDE1MCZzZGF0YT11 cFpiT2tBTEo4U3VFayUyRnBMTHFoZEREVU5NaGRwU21qV3FwTUF5SVR6YzglM0QmcmVzZXJ2ZWQ9 MD4gaXMNCg0KDQoNClVSSSA9IHNjaGVtZSAiOiIgaGllci1wYXJ0IFsgIj8iIHF1ZXJ5IF0gWyAi IyIgZnJhZ21lbnQgXQ0KDQoNCg0KZWFjaCBVUkkgaXMgZGVmaW5lZCBsaWtlIHRoaXMgYW5kIG11 c3QgaGF2ZSBhIGNvbG9uLg0KDQoNCg0KY2hlZXJzLA0KDQoNCg0KZHJldC4NCg0KDQoNCi0tDQoN CmVyaWsgd2lsZGUgfCBtYWlsdG86IGVyaWsud2lsZGVAZHJldC5uZXQ8bWFpbHRvOmVyaWsud2ls ZGVAZHJldC5uZXQ+IHwNCg0KfCBodHRwOi8vZHJldC5uZXQvbmV0ZHJldDxodHRwczovL25hbTA2 LnNhZmVsaW5rcy5wcm90ZWN0aW9uLm91dGxvb2suY29tLz91cmw9aHR0cCUzQSUyRiUyRmRyZXQu bmV0JTJGbmV0ZHJldCZkYXRhPTAyJTdDMDElN0NkdGhhbGVyJTQwbWljcm9zb2Z0LmNvbSU3Q2Ix MTVjN2Y4YzcwYjQxMGViOTgzMDhkODAyYTBhOGY0JTdDNzJmOTg4YmY4NmYxNDFhZjkxYWIyZDdj ZDAxMWRiNDclN0MxJTdDMCU3QzYzNzI2MjIzNjMzOTIxNDE1MCZzZGF0YT1ocThRVkRyWHhSbVYz aVM2REY3UiUyRmVYRnRES250TWNZT0huTFNNcXg1em8lM0QmcmVzZXJ2ZWQ9MD4gfA0KDQp8IGh0 dHA6Ly90d2l0dGVyLmNvbS9kcmV0PGh0dHBzOi8vbmFtMDYuc2FmZWxpbmtzLnByb3RlY3Rpb24u b3V0bG9vay5jb20vP3VybD1odHRwJTNBJTJGJTJGdHdpdHRlci5jb20lMkZkcmV0JmRhdGE9MDIl N0MwMSU3Q2R0aGFsZXIlNDBtaWNyb3NvZnQuY29tJTdDYjExNWM3ZjhjNzBiNDEwZWI5ODMwOGQ4 MDJhMGE4ZjQlN0M3MmY5ODhiZjg2ZjE0MWFmOTFhYjJkN2NkMDExZGI0NyU3QzElN0MwJTdDNjM3 MjYyMjM2MzM5MjI0MTA1JnNkYXRhPTlWNWwyY2d5Z0xGMkdKYlQ5RWgwcHRkMm12NFlSYnZabTZv YVlTcmY4ZkUlM0QmcmVzZXJ2ZWQ9MD4gfA0KDQoNCg== --_000_BL0PR2101MB10278A5360398EFF2E73FC0BA38E0BL0PR2101MB1027_ Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: base64 PGh0bWwgeG1sbnM6dj0idXJuOnNjaGVtYXMtbWljcm9zb2Z0LWNvbTp2bWwiIHhtbG5zOm89InVy bjpzY2hlbWFzLW1pY3Jvc29mdC1jb206b2ZmaWNlOm9mZmljZSIgeG1sbnM6dz0idXJuOnNjaGVt YXMtbWljcm9zb2Z0LWNvbTpvZmZpY2U6d29yZCIgeG1sbnM6ZHQ9InV1aWQ6QzJGNDEwMTAtNjVC My0xMWQxLUEyOUYtMDBBQTAwQzE0ODgyIiB4bWxuczptPSJodHRwOi8vc2NoZW1hcy5taWNyb3Nv ZnQuY29tL29mZmljZS8yMDA0LzEyL29tbWwiIHhtbG5zPSJodHRwOi8vd3d3LnczLm9yZy9UUi9S RUMtaHRtbDQwIj4NCjxoZWFkPg0KPG1ldGEgaHR0cC1lcXVpdj0iQ29udGVudC1UeXBlIiBjb250 ZW50PSJ0ZXh0L2h0bWw7IGNoYXJzZXQ9dXRmLTgiPg0KPG1ldGEgbmFtZT0iR2VuZXJhdG9yIiBj b250ZW50PSJNaWNyb3NvZnQgV29yZCAxNSAoZmlsdGVyZWQgbWVkaXVtKSI+DQo8c3R5bGU+PCEt LQ0KLyogRm9udCBEZWZpbml0aW9ucyAqLw0KQGZvbnQtZmFjZQ0KCXtmb250LWZhbWlseTpXaW5n ZGluZ3M7DQoJcGFub3NlLTE6NSAwIDAgMCAwIDAgMCAwIDAgMDt9DQpAZm9udC1mYWNlDQoJe2Zv bnQtZmFtaWx5OiJDYW1icmlhIE1hdGgiOw0KCXBhbm9zZS0xOjIgNCA1IDMgNSA0IDYgMyAyIDQ7 fQ0KQGZvbnQtZmFjZQ0KCXtmb250LWZhbWlseTpDYWxpYnJpOw0KCXBhbm9zZS0xOjIgMTUgNSAy IDIgMiA0IDMgMiA0O30NCi8qIFN0eWxlIERlZmluaXRpb25zICovDQpwLk1zb05vcm1hbCwgbGku TXNvTm9ybWFsLCBkaXYuTXNvTm9ybWFsDQoJe21hcmdpbjowaW47DQoJbWFyZ2luLWJvdHRvbTou MDAwMXB0Ow0KCWZvbnQtc2l6ZToxMi4wcHQ7DQoJZm9udC1mYW1pbHk6IlRpbWVzIE5ldyBSb21h biIsc2VyaWY7fQ0KYTpsaW5rLCBzcGFuLk1zb0h5cGVybGluaw0KCXttc28tc3R5bGUtcHJpb3Jp dHk6OTk7DQoJY29sb3I6Ymx1ZTsNCgl0ZXh0LWRlY29yYXRpb246dW5kZXJsaW5lO30NCmE6dmlz aXRlZCwgc3Bhbi5Nc29IeXBlcmxpbmtGb2xsb3dlZA0KCXttc28tc3R5bGUtcHJpb3JpdHk6OTk7 DQoJY29sb3I6cHVycGxlOw0KCXRleHQtZGVjb3JhdGlvbjp1bmRlcmxpbmU7fQ0KcC5tc29ub3Jt YWwwLCBsaS5tc29ub3JtYWwwLCBkaXYubXNvbm9ybWFsMA0KCXttc28tc3R5bGUtbmFtZTptc29u b3JtYWw7DQoJbXNvLW1hcmdpbi10b3AtYWx0OmF1dG87DQoJbWFyZ2luLXJpZ2h0OjBpbjsNCglt c28tbWFyZ2luLWJvdHRvbS1hbHQ6YXV0bzsNCgltYXJnaW4tbGVmdDowaW47DQoJZm9udC1zaXpl OjEyLjBwdDsNCglmb250LWZhbWlseToiVGltZXMgTmV3IFJvbWFuIixzZXJpZjt9DQpwLm94LTRm NmY3YWFlNzktbXNvbm9ybWFsLCBsaS5veC00ZjZmN2FhZTc5LW1zb25vcm1hbCwgZGl2Lm94LTRm NmY3YWFlNzktbXNvbm9ybWFsDQoJe21zby1zdHlsZS1uYW1lOm94LTRmNmY3YWFlNzktbXNvbm9y bWFsOw0KCW1zby1tYXJnaW4tdG9wLWFsdDphdXRvOw0KCW1hcmdpbi1yaWdodDowaW47DQoJbXNv LW1hcmdpbi1ib3R0b20tYWx0OmF1dG87DQoJbWFyZ2luLWxlZnQ6MGluOw0KCWZvbnQtc2l6ZTox Mi4wcHQ7DQoJZm9udC1mYW1pbHk6IlRpbWVzIE5ldyBSb21hbiIsc2VyaWY7fQ0Kc3Bhbi5FbWFp bFN0eWxlMTkNCgl7bXNvLXN0eWxlLXR5cGU6cGVyc29uYWw7DQoJZm9udC1mYW1pbHk6IkNhbGli cmkiLHNhbnMtc2VyaWY7DQoJY29sb3I6IzFGNDk3RDt9DQpzcGFuLkVtYWlsU3R5bGUyMQ0KCXtt c28tc3R5bGUtdHlwZTpwZXJzb25hbC1yZXBseTsNCglmb250LWZhbWlseToiQ2FsaWJyaSIsc2Fu cy1zZXJpZjsNCgljb2xvcjojMUY0OTdEO30NCi5Nc29DaHBEZWZhdWx0DQoJe21zby1zdHlsZS10 eXBlOmV4cG9ydC1vbmx5Ow0KCWZvbnQtc2l6ZToxMC4wcHQ7fQ0KQHBhZ2UgV29yZFNlY3Rpb24x DQoJe3NpemU6OC41aW4gMTEuMGluOw0KCW1hcmdpbjoxLjBpbiAxLjBpbiAxLjBpbiAxLjBpbjt9 DQpkaXYuV29yZFNlY3Rpb24xDQoJe3BhZ2U6V29yZFNlY3Rpb24xO30NCi0tPjwvc3R5bGU+PCEt LVtpZiBndGUgbXNvIDldPjx4bWw+DQo8bzpzaGFwZWRlZmF1bHRzIHY6ZXh0PSJlZGl0IiBzcGlk bWF4PSIxMDI2IiAvPg0KPC94bWw+PCFbZW5kaWZdLS0+PCEtLVtpZiBndGUgbXNvIDldPjx4bWw+ DQo8bzpzaGFwZWxheW91dCB2OmV4dD0iZWRpdCI+DQo8bzppZG1hcCB2OmV4dD0iZWRpdCIgZGF0 YT0iMSIgLz4NCjwvbzpzaGFwZWxheW91dD48L3htbD48IVtlbmRpZl0tLT4NCjwvaGVhZD4NCjxi b2R5IGxhbmc9IkVOLVVTIiBsaW5rPSJibHVlIiB2bGluaz0icHVycGxlIj4NCjxkaXYgY2xhc3M9 IldvcmRTZWN0aW9uMSI+DQo8cCBjbGFzcz0iTXNvTm9ybWFsIj48c3BhbiBzdHlsZT0iZm9udC1z aXplOjExLjBwdDtmb250LWZhbWlseTomcXVvdDtDYWxpYnJpJnF1b3Q7LHNhbnMtc2VyaWY7Y29s b3I6IzFGNDk3RCI+cy9VUkwvVVJJLyBpbiBib3RoIGNhc2VzIGluIG15IHJlc3BvbnNlDQo8L3Nw YW4+PHNwYW4gc3R5bGU9ImZvbnQtc2l6ZToxMS4wcHQ7Zm9udC1mYW1pbHk6V2luZ2RpbmdzO2Nv bG9yOiMxRjQ5N0QiPko8L3NwYW4+PHNwYW4gc3R5bGU9ImZvbnQtc2l6ZToxMS4wcHQ7Zm9udC1m YW1pbHk6JnF1b3Q7Q2FsaWJyaSZxdW90OyxzYW5zLXNlcmlmO2NvbG9yOiMxRjQ5N0QiPjxvOnA+ PC9vOnA+PC9zcGFuPjwvcD4NCjxwIGNsYXNzPSJNc29Ob3JtYWwiPjxzcGFuIHN0eWxlPSJmb250 LXNpemU6MTEuMHB0O2ZvbnQtZmFtaWx5OiZxdW90O0NhbGlicmkmcXVvdDssc2Fucy1zZXJpZjtj b2xvcjojMUY0OTdEIj48bzpwPiZuYnNwOzwvbzpwPjwvc3Bhbj48L3A+DQo8ZGl2Pg0KPGRpdiBz dHlsZT0iYm9yZGVyOm5vbmU7Ym9yZGVyLXRvcDpzb2xpZCAjRTFFMUUxIDEuMHB0O3BhZGRpbmc6 My4wcHQgMGluIDBpbiAwaW4iPg0KPHAgY2xhc3M9Ik1zb05vcm1hbCI+PGI+PHNwYW4gc3R5bGU9 ImZvbnQtc2l6ZToxMS4wcHQ7Zm9udC1mYW1pbHk6JnF1b3Q7Q2FsaWJyaSZxdW90OyxzYW5zLXNl cmlmIj5Gcm9tOjwvc3Bhbj48L2I+PHNwYW4gc3R5bGU9ImZvbnQtc2l6ZToxMS4wcHQ7Zm9udC1m YW1pbHk6JnF1b3Q7Q2FsaWJyaSZxdW90OyxzYW5zLXNlcmlmIj4gVXJpLXJldmlldyAmbHQ7dXJp LXJldmlldy1ib3VuY2VzQGlldGYub3JnJmd0Ow0KPGI+T24gQmVoYWxmIE9mIDwvYj5EYXZlIFRo YWxlcjxicj4NCjxiPlNlbnQ6PC9iPiBXZWRuZXNkYXksIE1heSAyNywgMjAyMCA1OjQ3IFBNPGJy Pg0KPGI+VG86PC9iPiBUaW1vdGh5IE1jc3dlZW5leSAmbHQ7dGltQGRyb3BudW1iZXIuY29tJmd0 OzsgdXJpLXJldmlld0BpZXRmLm9yZzxicj4NCjxiPlN1YmplY3Q6PC9iPiBSZTogW1VyaS1yZXZp ZXddIFJlcXVlc3QgZm9yIHJldmlldzxvOnA+PC9vOnA+PC9zcGFuPjwvcD4NCjwvZGl2Pg0KPC9k aXY+DQo8cCBjbGFzcz0iTXNvTm9ybWFsIj48bzpwPiZuYnNwOzwvbzpwPjwvcD4NCjxwIGNsYXNz PSJNc29Ob3JtYWwiPjxzcGFuIHN0eWxlPSJmb250LXNpemU6MTEuMHB0O2ZvbnQtZmFtaWx5OiZx dW90O0NhbGlicmkmcXVvdDssc2Fucy1zZXJpZjtjb2xvcjojMUY0OTdEIj5JIGRvbuKAmXQgdW5k ZXJzdGFuZCB5b3VyIHF1ZXN0aW9uLiZuYnNwOyZuYnNwOyBUaGUgVVJMIHN5bnRheCBpcyBmaXhl ZCBieSB0aGF0IFJGQy48bzpwPjwvbzpwPjwvc3Bhbj48L3A+DQo8cCBjbGFzcz0iTXNvTm9ybWFs Ij48c3BhbiBzdHlsZT0iZm9udC1zaXplOjExLjBwdDtmb250LWZhbWlseTomcXVvdDtDYWxpYnJp JnF1b3Q7LHNhbnMtc2VyaWY7Y29sb3I6IzFGNDk3RCI+SSBkb27igJl0IGtub3cgd2hhdCB5b3Ug bWVhbiBieSDigJxzYWZl4oCdIG9yIOKAnHZhbGlk4oCdLjxvOnA+PC9vOnA+PC9zcGFuPjwvcD4N CjxwIGNsYXNzPSJNc29Ob3JtYWwiPjxzcGFuIHN0eWxlPSJmb250LXNpemU6MTEuMHB0O2ZvbnQt ZmFtaWx5OiZxdW90O0NhbGlicmkmcXVvdDssc2Fucy1zZXJpZjtjb2xvcjojMUY0OTdEIj48bzpw PiZuYnNwOzwvbzpwPjwvc3Bhbj48L3A+DQo8cCBjbGFzcz0iTXNvTm9ybWFsIj48c3BhbiBzdHls ZT0iZm9udC1zaXplOjExLjBwdDtmb250LWZhbWlseTomcXVvdDtDYWxpYnJpJnF1b3Q7LHNhbnMt c2VyaWY7Y29sb3I6IzFGNDk3RCI+SWYgYnkg4oCcdmFsaWTigJ0geW91IG1lYW4g4oCcYWxsb3dl ZCBieSBSRkMgMzk4NuKAnSwgdGhlIGFuc3dlciBpcyB0aGF0IHRoZXkgbWF5IG9ubHkgYXBwZWFy IGluIGEgVVJMIGxpdGVyYWxseTxvOnA+PC9vOnA+PC9zcGFuPjwvcD4NCjxwIGNsYXNzPSJNc29O b3JtYWwiPjxzcGFuIHN0eWxlPSJmb250LXNpemU6MTEuMHB0O2ZvbnQtZmFtaWx5OiZxdW90O0Nh bGlicmkmcXVvdDssc2Fucy1zZXJpZjtjb2xvcjojMUY0OTdEIj5pZiB0aGV5IGhhdmUgdGhlIGV4 YWN0IG1lYW5pbmcgaW4gdGhlIFJGQywgb3RoZXJ3aXNlIHRoZXkgbXVzdCBiZSBwY3QtZW5jb2Rl ZC48bzpwPjwvbzpwPjwvc3Bhbj48L3A+DQo8cCBjbGFzcz0iTXNvTm9ybWFsIj48c3BhbiBzdHls ZT0iZm9udC1zaXplOjExLjBwdDtmb250LWZhbWlseTomcXVvdDtDYWxpYnJpJnF1b3Q7LHNhbnMt c2VyaWY7Y29sb3I6IzFGNDk3RCI+PG86cD4mbmJzcDs8L286cD48L3NwYW4+PC9wPg0KPHAgY2xh c3M9Ik1zb05vcm1hbCI+PHNwYW4gc3R5bGU9ImZvbnQtc2l6ZToxMS4wcHQ7Zm9udC1mYW1pbHk6 JnF1b3Q7Q2FsaWJyaSZxdW90OyxzYW5zLXNlcmlmO2NvbG9yOiMxRjQ5N0QiPjxvOnA+Jm5ic3A7 PC9vOnA+PC9zcGFuPjwvcD4NCjxkaXY+DQo8ZGl2IHN0eWxlPSJib3JkZXI6bm9uZTtib3JkZXIt dG9wOnNvbGlkICNFMUUxRTEgMS4wcHQ7cGFkZGluZzozLjBwdCAwaW4gMGluIDBpbiI+DQo8cCBj bGFzcz0iTXNvTm9ybWFsIj48Yj48c3BhbiBzdHlsZT0iZm9udC1zaXplOjExLjBwdDtmb250LWZh bWlseTomcXVvdDtDYWxpYnJpJnF1b3Q7LHNhbnMtc2VyaWYiPkZyb206PC9zcGFuPjwvYj48c3Bh biBzdHlsZT0iZm9udC1zaXplOjExLjBwdDtmb250LWZhbWlseTomcXVvdDtDYWxpYnJpJnF1b3Q7 LHNhbnMtc2VyaWYiPiBVcmktcmV2aWV3ICZsdDs8YSBocmVmPSJtYWlsdG86dXJpLXJldmlldy1i b3VuY2VzQGlldGYub3JnIj51cmktcmV2aWV3LWJvdW5jZXNAaWV0Zi5vcmc8L2E+Jmd0Ow0KPGI+ T24gQmVoYWxmIE9mIDwvYj5UaW1vdGh5IE1jc3dlZW5leTxicj4NCjxiPlNlbnQ6PC9iPiBXZWRu ZXNkYXksIE1heSAyNywgMjAyMCA1OjA1IFBNPGJyPg0KPGI+VG86PC9iPiA8YSBocmVmPSJtYWls dG86dXJpLXJldmlld0BpZXRmLm9yZyI+dXJpLXJldmlld0BpZXRmLm9yZzwvYT48YnI+DQo8Yj5T dWJqZWN0OjwvYj4gUmU6IFtVcmktcmV2aWV3XSBSZXF1ZXN0IGZvciByZXZpZXc8bzpwPjwvbzpw Pjwvc3Bhbj48L3A+DQo8L2Rpdj4NCjwvZGl2Pg0KPHAgY2xhc3M9Ik1zb05vcm1hbCI+PG86cD4m bmJzcDs8L286cD48L3A+DQo8ZGl2Pg0KPGRpdj4NCjxwIGNsYXNzPSJNc29Ob3JtYWwiPkhpIERh dmUsJm5ic3A7IDxvOnA+PC9vOnA+PC9wPg0KPC9kaXY+DQo8cCBjbGFzcz0iTXNvTm9ybWFsIj48 bzpwPiZuYnNwOzwvbzpwPjwvcD4NCjxkaXY+DQo8cCBjbGFzcz0iTXNvTm9ybWFsIj5JZiB0aGUg b3RoZXIgc2l4IGdlbi1kZWxpbXMgZnJvbSB0aGUgcmVzZXJ2ZWQgc2V0IHdlcmUgc2FmZSBhbmQg dmFsaWQsIHdvdWxkIHlvdSBvcHBvc2UgdGhlaXIgdXNlIGluIFVSSXM/DQo8bzpwPjwvbzpwPjwv cD4NCjwvZGl2Pg0KPHAgY2xhc3M9Ik1zb05vcm1hbCI+PG86cD4mbmJzcDs8L286cD48L3A+DQo8 ZGl2Pg0KPHAgY2xhc3M9Ik1zb05vcm1hbCI+VGltIDxvOnA+PC9vOnA+PC9wPg0KPC9kaXY+DQo8 L2Rpdj4NCjxkaXY+DQo8cCBjbGFzcz0iTXNvTm9ybWFsIj48bzpwPiZuYnNwOzwvbzpwPjwvcD4N CjwvZGl2Pg0KPGRpdj4NCjxwIGNsYXNzPSJNc29Ob3JtYWwiPjxvOnA+Jm5ic3A7PC9vOnA+PC9w Pg0KPC9kaXY+DQo8ZGl2Pg0KPHAgY2xhc3M9Ik1zb05vcm1hbCI+PG86cD4mbmJzcDs8L286cD48 L3A+DQo8L2Rpdj4NCjxibG9ja3F1b3RlIHN0eWxlPSJtYXJnaW4tdG9wOjUuMHB0O21hcmdpbi1i b3R0b206NS4wcHQiPg0KPHAgY2xhc3M9Ik1zb05vcm1hbCIgc3R5bGU9Im1hcmdpbi1ib3R0b206 MTIuMHB0Ij5PbiBNYXkgMjQsIDIwMjAgYXQgNjowOCBQTSBEYXZlIFRoYWxlciAmbHQ7PGEgaHJl Zj0ibWFpbHRvOmR0aGFsZXJAbWljcm9zb2Z0LmNvbSI+ZHRoYWxlckBtaWNyb3NvZnQuY29tPC9h PiZndDsgd3JvdGU6DQo8bzpwPjwvbzpwPjwvcD4NCjxkaXY+DQo8cCBjbGFzcz0ib3gtNGY2Zjdh YWU3OS1tc29ub3JtYWwiPjxzcGFuIHN0eWxlPSJmb250LXNpemU6MTEuMHB0O2ZvbnQtZmFtaWx5 OiZxdW90O0NhbGlicmkmcXVvdDssc2Fucy1zZXJpZjtjb2xvcjojMUY0OTdEIj5IaSBUaW0sDQo8 L3NwYW4+PG86cD48L286cD48L3A+DQo8cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1tc29ub3JtYWwi PjxzcGFuIHN0eWxlPSJmb250LXNpemU6MTEuMHB0O2ZvbnQtZmFtaWx5OiZxdW90O0NhbGlicmkm cXVvdDssc2Fucy1zZXJpZjtjb2xvcjojMUY0OTdEIj4mbmJzcDsNCjwvc3Bhbj48bzpwPjwvbzpw PjwvcD4NCjxwIGNsYXNzPSJveC00ZjZmN2FhZTc5LW1zb25vcm1hbCI+PHNwYW4gc3R5bGU9ImZv bnQtc2l6ZToxMS4wcHQ7Zm9udC1mYW1pbHk6JnF1b3Q7Q2FsaWJyaSZxdW90OyxzYW5zLXNlcmlm O2NvbG9yOiMxRjQ5N0QiPkNvcnJlY3QgdGhlIGNvbG9uIGlzIG5vdCBwYXJ0IG9mIHRoZSBoaWVy LXBhcnQsIHRoZSBoaWVyLXBhcnQgaXMgd2hhdCBjb21lcyBhZnRlciB0aGUgY29sb24uJm5ic3A7 IFJGQyAzOTg2IHNheXM6DQo8L3NwYW4+PG86cD48L286cD48L3A+DQo8cCBjbGFzcz0ib3gtNGY2 ZjdhYWU3OS1tc29ub3JtYWwiPjxzcGFuIHN0eWxlPSJmb250LXNpemU6MTEuMHB0O2ZvbnQtZmFt aWx5OiZxdW90O0NhbGlicmkmcXVvdDssc2Fucy1zZXJpZjtjb2xvcjojMUY0OTdEIj4mbmJzcDsN Cjwvc3Bhbj48bzpwPjwvbzpwPjwvcD4NCjxwIGNsYXNzPSJveC00ZjZmN2FhZTc5LW1zb25vcm1h bCI+PHNwYW4gc3R5bGU9ImZvbnQtc2l6ZToxMC4wcHQ7Zm9udC1mYW1pbHk6JnF1b3Q7Q291cmll ciBOZXcmcXVvdDs7Y29sb3I6YmxhY2siPlVSSSZuYnNwOyZuYnNwOyZuYnNwOyZuYnNwOyZuYnNw OyZuYnNwOyZuYnNwOyZuYnNwOyA9IHNjaGVtZSAmcXVvdDs6JnF1b3Q7IGhpZXItcGFydCBbICZx dW90Oz8mcXVvdDsgcXVlcnkgXSBbICZxdW90OyMmcXVvdDsgZnJhZ21lbnQgXQ0KPC9zcGFuPjxv OnA+PC9vOnA+PC9wPg0KPHAgY2xhc3M9Im94LTRmNmY3YWFlNzktbXNvbm9ybWFsIj48c3BhbiBz dHlsZT0iZm9udC1zaXplOjExLjBwdDtmb250LWZhbWlseTomcXVvdDtDYWxpYnJpJnF1b3Q7LHNh bnMtc2VyaWY7Y29sb3I6IzFGNDk3RCI+Jm5ic3A7DQo8L3NwYW4+PG86cD48L286cD48L3A+DQo8 cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1tc29ub3JtYWwiPjxzcGFuIHN0eWxlPSJmb250LXNpemU6 MTEuMHB0O2ZvbnQtZmFtaWx5OiZxdW90O0NhbGlicmkmcXVvdDssc2Fucy1zZXJpZjtjb2xvcjoj MUY0OTdEIj5Pbmx5IHN0cmluZ3MgdGhhdCBjb25mb3JtIHRvIHRoZSBhYm92ZSBhcmUgVVJJcy4N Cjwvc3Bhbj48bzpwPjwvbzpwPjwvcD4NCjxwIGNsYXNzPSJveC00ZjZmN2FhZTc5LW1zb25vcm1h bCI+PHNwYW4gc3R5bGU9ImZvbnQtc2l6ZToxMS4wcHQ7Zm9udC1mYW1pbHk6JnF1b3Q7Q2FsaWJy aSZxdW90OyxzYW5zLXNlcmlmO2NvbG9yOiMxRjQ5N0QiPlNvIOKAnGRyb3Ajc2Q1NGc1NOKAnSBp cyBub3QgYSBVUkkgYmVjYXVzZSBpdCBkb2VzIG5vdCBjb25mb3JtIHRvIHRoZSBhYm92ZSBzeW50 YXgsIGFzIGl0IGhhcyBubyDigJw64oCdDQo8L3NwYW4+PG86cD48L286cD48L3A+DQo8cCBjbGFz cz0ib3gtNGY2ZjdhYWU3OS1tc29ub3JtYWwiPjxzcGFuIHN0eWxlPSJmb250LXNpemU6MTEuMHB0 O2ZvbnQtZmFtaWx5OiZxdW90O0NhbGlicmkmcXVvdDssc2Fucy1zZXJpZjtjb2xvcjojMUY0OTdE Ij4mbmJzcDsNCjwvc3Bhbj48bzpwPjwvbzpwPjwvcD4NCjxwIGNsYXNzPSJveC00ZjZmN2FhZTc5 LW1zb25vcm1hbCI+PHNwYW4gc3R5bGU9ImZvbnQtc2l6ZToxMS4wcHQ7Zm9udC1mYW1pbHk6JnF1 b3Q7Q2FsaWJyaSZxdW90OyxzYW5zLXNlcmlmO2NvbG9yOiMxRjQ5N0QiPuKAnGRyb3A6c2Q1NGc1 NOKAnSBvbiB0aGUgb3RoZXIgaGFuZCB3b3VsZCBiZSBhIHZhbGlkIFVSSS4NCjwvc3Bhbj48bzpw PjwvbzpwPjwvcD4NCjxwIGNsYXNzPSJveC00ZjZmN2FhZTc5LW1zb25vcm1hbCI+PHNwYW4gc3R5 bGU9ImZvbnQtc2l6ZToxMS4wcHQ7Zm9udC1mYW1pbHk6JnF1b3Q7Q2FsaWJyaSZxdW90OyxzYW5z LXNlcmlmO2NvbG9yOiMxRjQ5N0QiPiZuYnNwOw0KPC9zcGFuPjxvOnA+PC9vOnA+PC9wPg0KPHAg Y2xhc3M9Im94LTRmNmY3YWFlNzktbXNvbm9ybWFsIj48c3BhbiBzdHlsZT0iZm9udC1zaXplOjEx LjBwdDtmb250LWZhbWlseTomcXVvdDtDYWxpYnJpJnF1b3Q7LHNhbnMtc2VyaWY7Y29sb3I6IzFG NDk3RCI+VGhpcyBpcyB3aGF0IGZvbGtzIGFyZSBzYXlpbmcgd2hlbiB0aGV5IHNheSBpZiB5b3Ug anVzdCBjaGFuZ2UgdGhlIOKAnCPigJ0gdG8gYSDigJw64oCdIGluIHlvdXIgZHJhZnQgdGhlbiBp dCBiZWNvbWVzIGxlZ2FsLg0KPC9zcGFuPjxvOnA+PC9vOnA+PC9wPg0KPHAgY2xhc3M9Im94LTRm NmY3YWFlNzktbXNvbm9ybWFsIj48c3BhbiBzdHlsZT0iZm9udC1zaXplOjExLjBwdDtmb250LWZh bWlseTomcXVvdDtDYWxpYnJpJnF1b3Q7LHNhbnMtc2VyaWY7Y29sb3I6IzFGNDk3RCI+Jm5ic3A7 DQo8L3NwYW4+PG86cD48L286cD48L3A+DQo8cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1tc29ub3Jt YWwiPjxzcGFuIHN0eWxlPSJmb250LXNpemU6MTEuMHB0O2ZvbnQtZmFtaWx5OiZxdW90O0NhbGli cmkmcXVvdDssc2Fucy1zZXJpZjtjb2xvcjojMUY0OTdEIj5EYXZlDQo8L3NwYW4+PG86cD48L286 cD48L3A+DQo8cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1tc29ub3JtYWwiPjxzcGFuIHN0eWxlPSJm b250LXNpemU6MTEuMHB0O2ZvbnQtZmFtaWx5OiZxdW90O0NhbGlicmkmcXVvdDssc2Fucy1zZXJp Zjtjb2xvcjojMUY0OTdEIj4mbmJzcDsNCjwvc3Bhbj48bzpwPjwvbzpwPjwvcD4NCjxkaXY+DQo8 ZGl2IHN0eWxlPSJib3JkZXI6bm9uZTtib3JkZXItdG9wOnNvbGlkICNFMUUxRTEgMS4wcHQ7cGFk ZGluZzozLjBwdCAwaW4gMGluIDBpbiI+DQo8cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1tc29ub3Jt YWwiPjxzdHJvbmc+PHNwYW4gc3R5bGU9ImZvbnQtc2l6ZToxMS4wcHQ7Zm9udC1mYW1pbHk6JnF1 b3Q7Q2FsaWJyaSZxdW90OyxzYW5zLXNlcmlmIj5Gcm9tOjwvc3Bhbj48L3N0cm9uZz48c3BhbiBz dHlsZT0iZm9udC1zaXplOjExLjBwdDtmb250LWZhbWlseTomcXVvdDtDYWxpYnJpJnF1b3Q7LHNh bnMtc2VyaWYiPiBVcmktcmV2aWV3ICZsdDs8YSBocmVmPSJtYWlsdG86dXJpLXJldmlldy1ib3Vu Y2VzQGlldGYub3JnIj51cmktcmV2aWV3LWJvdW5jZXNAaWV0Zi5vcmc8L2E+Jmd0Ow0KPHN0cm9u Zz48c3BhbiBzdHlsZT0iZm9udC1mYW1pbHk6JnF1b3Q7Q2FsaWJyaSZxdW90OyxzYW5zLXNlcmlm Ij5PbiBCZWhhbGYgT2YgPC9zcGFuPjwvc3Ryb25nPlRpbW90aHkgTWNzd2VlbmV5PGJyPg0KPHN0 cm9uZz48c3BhbiBzdHlsZT0iZm9udC1mYW1pbHk6JnF1b3Q7Q2FsaWJyaSZxdW90OyxzYW5zLXNl cmlmIj5TZW50Ojwvc3Bhbj48L3N0cm9uZz4gU3VuZGF5LCBNYXkgMjQsIDIwMjAgMTE6MjYgQU08 YnI+DQo8c3Ryb25nPjxzcGFuIHN0eWxlPSJmb250LWZhbWlseTomcXVvdDtDYWxpYnJpJnF1b3Q7 LHNhbnMtc2VyaWYiPlRvOjwvc3Bhbj48L3N0cm9uZz4gRXJpayBXaWxkZSAmbHQ7PGEgaHJlZj0i bWFpbHRvOmVyaWsud2lsZGVAZHJldC5uZXQiPmVyaWsud2lsZGVAZHJldC5uZXQ8L2E+Jmd0OzsN CjxhIGhyZWY9Im1haWx0bzp1cmktcmV2aWV3QGlldGYub3JnIj51cmktcmV2aWV3QGlldGYub3Jn PC9hPjxicj4NCjxzdHJvbmc+PHNwYW4gc3R5bGU9ImZvbnQtZmFtaWx5OiZxdW90O0NhbGlicmkm cXVvdDssc2Fucy1zZXJpZiI+U3ViamVjdDo8L3NwYW4+PC9zdHJvbmc+IFJlOiBbVXJpLXJldmll d10gUmVxdWVzdCBmb3IgcmV2aWV3DQo8L3NwYW4+PG86cD48L286cD48L3A+DQo8L2Rpdj4NCjwv ZGl2Pg0KPHAgY2xhc3M9Im94LTRmNmY3YWFlNzktbXNvbm9ybWFsIj48bzpwPiZuYnNwOzwvbzpw PjwvcD4NCjxkaXY+DQo8cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1tc29ub3JtYWwiPkhpIEVyaWss Jm5ic3A7PG86cD48L286cD48L3A+DQo8L2Rpdj4NCjxkaXY+DQo8cCBjbGFzcz0ib3gtNGY2Zjdh YWU3OS1tc29ub3JtYWwiPjxvOnA+Jm5ic3A7PC9vOnA+PC9wPg0KPC9kaXY+DQo8ZGl2Pg0KPHAg Y2xhc3M9Im94LTRmNmY3YWFlNzktbXNvbm9ybWFsIj5UaGFuayB5b3UsIEkgd2lsbCBoYXZlIGFu b3RoZXIgbG9vayBhdCBteSByZWZlcmVuY2UgdG8gc2VjdGlvbiAzLiZuYnNwOyAmbmJzcDs8bzpw PjwvbzpwPjwvcD4NCjwvZGl2Pg0KPGRpdj4NCjxwIGNsYXNzPSJveC00ZjZmN2FhZTc5LW1zb25v cm1hbCI+V291bGQgeW91IGFncmVlIHRoYXQgaW4gJnF1b3Q7PGEgaHJlZj0iaHR0cHM6Ly9uYW0w Ni5zYWZlbGlua3MucHJvdGVjdGlvbi5vdXRsb29rLmNvbS8/dXJsPWh0dHBzJTNBJTJGJTJGaWV0 Zi5vcmclMkYmYW1wO2RhdGE9MDIlN0MwMSU3Q2R0aGFsZXIlNDBtaWNyb3NvZnQuY29tJTdDYjEx NWM3ZjhjNzBiNDEwZWI5ODMwOGQ4MDJhMGE4ZjQlN0M3MmY5ODhiZjg2ZjE0MWFmOTFhYjJkN2Nk MDExZGI0NyU3QzElN0MwJTdDNjM3MjYyMjM2MzM5MjA0MTkyJmFtcDtzZGF0YT1VSjdUUW5LZkda TW5Xa0JLWkNWb3paUWhuJTJCR2lyMXNhaVBRb05HVjJDOU0lM0QmYW1wO3Jlc2VydmVkPTAiPmh0 dHBzOi8vaWV0Zi5vcmc8L2E+JnF1b3Q7DQogdGhlIGNvbG9uIGlzIG5vdCBwYXJ0IG9mIHRoZSBo aWVyLXBhcnQ/Jm5ic3A7PG86cD48L286cD48L3A+DQo8L2Rpdj4NCjxibG9ja3F1b3RlIHN0eWxl PSJtYXJnaW4tdG9wOjUuMHB0O21hcmdpbi1ib3R0b206NS4wcHQiPg0KPGRpdj4NCjxwIGNsYXNz PSJveC00ZjZmN2FhZTc5LW1zb25vcm1hbCI+T24gTWF5IDI0LCAyMDIwIGF0IDEyOjAyIFBNIEVy aWsgV2lsZGUgJmx0OyA8YSBocmVmPSJtYWlsdG86ZXJpay53aWxkZUBkcmV0Lm5ldCI+DQplcmlr LndpbGRlQGRyZXQubmV0PC9hPiZndDsgd3JvdGU6PG86cD48L286cD48L3A+DQo8L2Rpdj4NCjxk aXY+DQo8cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1tc29ub3JtYWwiPjxvOnA+Jm5ic3A7PC9vOnA+ PC9wPg0KPC9kaXY+DQo8ZGl2Pg0KPHAgY2xhc3M9Im94LTRmNmY3YWFlNzktbXNvbm9ybWFsIj48 bzpwPiZuYnNwOzwvbzpwPjwvcD4NCjwvZGl2Pg0KPGRpdj4NCjxwIGNsYXNzPSJveC00ZjZmN2Fh ZTc5LW1zb25vcm1hbCI+aGV5IHRpbS48bzpwPjwvbzpwPjwvcD4NCjwvZGl2Pg0KPGRpdj4NCjxw IGNsYXNzPSJveC00ZjZmN2FhZTc5LW1zb25vcm1hbCI+PG86cD4mbmJzcDs8L286cD48L3A+DQo8 L2Rpdj4NCjxkaXY+DQo8cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1tc29ub3JtYWwiPk9uIDIwMjAt MDUtMjQgMTc6NTMsIFRpbW90aHkgTWNzd2VlbmV5IHdyb3RlOjxvOnA+PC9vOnA+PC9wPg0KPC9k aXY+DQo8YmxvY2txdW90ZSBzdHlsZT0ibWFyZ2luLXRvcDo1LjBwdDttYXJnaW4tYm90dG9tOjUu MHB0Ij4NCjxkaXY+DQo8cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1tc29ub3JtYWwiPlllcywgSSBh Z3JlZSBhbmQgdW5kZXJzdGFuZCB0aGF0IHRoZSBzYW1lIHdheSBhcyB5b3UuJm5ic3A7ICZuYnNw O0J1dCB3aGVuIHRoZSAmcXVvdDsjJnF1b3Q7PG86cD48L286cD48L3A+DQo8L2Rpdj4NCjxkaXY+ DQo8cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1tc29ub3JtYWwiPmxlYXZlcyB0aGUgY2xpZW50IGl0 IGlzIG5vdCBsZWF2aW5nIGFzIGEgZnJhZ21lbnQsPG86cD48L286cD48L3A+DQo8L2Rpdj4NCjwv YmxvY2txdW90ZT4NCjxkaXY+DQo8cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1tc29ub3JtYWwiPndo YXQgcGVvcGxlIGFyZSB0ZWxsaW5nIHlvdSBpcyB0aGF0ICZxdW90OyMmcXVvdDsgYW5kIGFueXRo aW5nIGZvbGxvd2luZyBpdCBuZXZlcjxvOnA+PC9vOnA+PC9wPg0KPC9kaXY+DQo8ZGl2Pg0KPHAg Y2xhc3M9Im94LTRmNmY3YWFlNzktbXNvbm9ybWFsIj5sZWF2ZXMgdGhlIGNsaWVudCwgYnkgZGVm aW5pdGlvbi4uPG86cD48L286cD48L3A+DQo8L2Rpdj4NCjxkaXY+DQo8cCBjbGFzcz0ib3gtNGY2 ZjdhYWU3OS1tc29ub3JtYWwiPjxvOnA+Jm5ic3A7PC9vOnA+PC9wPg0KPC9kaXY+DQo8YmxvY2tx dW90ZSBzdHlsZT0ibWFyZ2luLXRvcDo1LjBwdDttYXJnaW4tYm90dG9tOjUuMHB0Ij4NCjxkaXY+ DQo8cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1tc29ub3JtYWwiPml0IGlzIGxlYXZpbmcgYXMgYTxv OnA+PC9vOnA+PC9wPg0KPC9kaXY+DQo8ZGl2Pg0KPHAgY2xhc3M9Im94LTRmNmY3YWFlNzktbXNv bm9ybWFsIj53YXkgdG8gc2VwYXJhdGUgdGhlIFVSSSBjb21wb25lbnRzLCAmbHQ7c2NoZW1lJmd0 OyBhbmQgJmx0O3BhdGgmZ3Q7IG9yIGZvciBodHRwIGl0PG86cD48L286cD48L3A+DQo8L2Rpdj4N CjxkaXY+DQo8cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1tc29ub3JtYWwiPndvdWxkIGJlIHNlcGFy YXRpbmcgJmx0O3NjaGVtZSZndDsgYW5kICZsdDthdXRob3JpdHkmZ3Q7LiZuYnNwOyBJdCBpcyB0 aGlzIHRoYXQgbWFrZXMgbWU8bzpwPjwvbzpwPjwvcD4NCjwvZGl2Pg0KPGRpdj4NCjxwIGNsYXNz PSJveC00ZjZmN2FhZTc5LW1zb25vcm1hbCI+YmVsaWV2ZSB0aGF0IGV2ZW4gaWYgdGhlIGNvbG9u IGlzIHJlcXVpcmVkIGZvciBodHRwIHJlc29sdXRpb24sIGl0IGlzPG86cD48L286cD48L3A+DQo8 L2Rpdj4NCjxkaXY+DQo8cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1tc29ub3JtYWwiPm5vdCBuZWNl c3NhcmlseSByZXF1aXJlZCBmb3IgYWxsIFVSSS48bzpwPjwvbzpwPjwvcD4NCjwvZGl2Pg0KPC9i bG9ja3F1b3RlPg0KPGRpdj4NCjxwIGNsYXNzPSJveC00ZjZmN2FhZTc5LW1zb25vcm1hbCI+dGhp cyBkaXNjdXNzaW9uIGNvdWxkIGJlIG1vcmUgcHJvZHVjdGl2ZSBpZiB5b3UgaGFkIGEgYnJpZWYg bG9vayBhdCB0aGU8bzpwPjwvbzpwPjwvcD4NCjwvZGl2Pg0KPGRpdj4NCjxwIGNsYXNzPSJveC00 ZjZmN2FhZTc5LW1zb25vcm1hbCI+c3BlY3MgeW91J3JlIGRlcGVuZGluZyBvbi4gdGhlIHZlcnkg Zmlyc3QgcnVsZSBzaG93biBpbjxvOnA+PC9vOnA+PC9wPg0KPC9kaXY+DQo8ZGl2Pg0KPHAgY2xh c3M9Im94LTRmNmY3YWFlNzktbXNvbm9ybWFsIj48YSBocmVmPSJodHRwczovL25hbTA2LnNhZmVs aW5rcy5wcm90ZWN0aW9uLm91dGxvb2suY29tLz91cmw9aHR0cHMlM0ElMkYlMkZ0b29scy5pZXRm Li5vcmclMkZodG1sJTJGcmZjMzk4NiUyM3NlY3Rpb24tMyZhbXA7ZGF0YT0wMiU3QzAxJTdDZHRo YWxlciU0MG1pY3Jvc29mdC5jb20lN0NiMTE1YzdmOGM3MGI0MTBlYjk4MzA4ZDgwMmEwYThmNCU3 QzcyZjk4OGJmODZmMTQxYWY5MWFiMmQ3Y2QwMTFkYjQ3JTdDMSU3QzAlN0M2MzcyNjIyMzYzMzky MTQxNTAmYW1wO3NkYXRhPXVwWmJPa0FMSjhTdUVrJTJGcExMcWhkRERVTk1oZHBTbWpXcXBNQXlJ VHpjOCUzRCZhbXA7cmVzZXJ2ZWQ9MCIgdGFyZ2V0PSJfYmxhbmsiPmh0dHBzOi8vdG9vbHMuaWV0 Zi5vcmcvaHRtbC9yZmMzOTg2I3NlY3Rpb24tMzwvYT4NCiBpczxvOnA+PC9vOnA+PC9wPg0KPC9k aXY+DQo8ZGl2Pg0KPHAgY2xhc3M9Im94LTRmNmY3YWFlNzktbXNvbm9ybWFsIj48bzpwPiZuYnNw OzwvbzpwPjwvcD4NCjwvZGl2Pg0KPGRpdj4NCjxwIGNsYXNzPSJveC00ZjZmN2FhZTc5LW1zb25v cm1hbCI+VVJJID0gc2NoZW1lICZxdW90OzomcXVvdDsgaGllci1wYXJ0IFsgJnF1b3Q7PyZxdW90 OyBxdWVyeSBdIFsgJnF1b3Q7IyZxdW90OyBmcmFnbWVudCBdPG86cD48L286cD48L3A+DQo8L2Rp dj4NCjxkaXY+DQo8cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1tc29ub3JtYWwiPjxvOnA+Jm5ic3A7 PC9vOnA+PC9wPg0KPC9kaXY+DQo8ZGl2Pg0KPHAgY2xhc3M9Im94LTRmNmY3YWFlNzktbXNvbm9y bWFsIj5lYWNoIFVSSSBpcyBkZWZpbmVkIGxpa2UgdGhpcyBhbmQgbXVzdCBoYXZlIGEgY29sb24u PG86cD48L286cD48L3A+DQo8L2Rpdj4NCjxkaXY+DQo8cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1t c29ub3JtYWwiPjxvOnA+Jm5ic3A7PC9vOnA+PC9wPg0KPC9kaXY+DQo8ZGl2Pg0KPHAgY2xhc3M9 Im94LTRmNmY3YWFlNzktbXNvbm9ybWFsIj5jaGVlcnMsPG86cD48L286cD48L3A+DQo8L2Rpdj4N CjxkaXY+DQo8cCBjbGFzcz0ib3gtNGY2ZjdhYWU3OS1tc29ub3JtYWwiPjxvOnA+Jm5ic3A7PC9v OnA+PC9wPg0KPC9kaXY+DQo8ZGl2Pg0KPHAgY2xhc3M9Im94LTRmNmY3YWFlNzktbXNvbm9ybWFs Ij5kcmV0LjxvOnA+PC9vOnA+PC9wPg0KPC9kaXY+DQo8ZGl2Pg0KPHAgY2xhc3M9Im94LTRmNmY3 YWFlNzktbXNvbm9ybWFsIj48bzpwPiZuYnNwOzwvbzpwPjwvcD4NCjwvZGl2Pg0KPGRpdj4NCjxw IGNsYXNzPSJveC00ZjZmN2FhZTc5LW1zb25vcm1hbCI+LS08bzpwPjwvbzpwPjwvcD4NCjwvZGl2 Pg0KPGRpdj4NCjxwIGNsYXNzPSJveC00ZjZmN2FhZTc5LW1zb25vcm1hbCI+ZXJpayB3aWxkZSB8 IG1haWx0bzogPGEgaHJlZj0ibWFpbHRvOmVyaWsud2lsZGVAZHJldC5uZXQiPg0KZXJpay53aWxk ZUBkcmV0Lm5ldDwvYT4gfDxvOnA+PC9vOnA+PC9wPg0KPC9kaXY+DQo8ZGl2Pg0KPHAgY2xhc3M9 Im94LTRmNmY3YWFlNzktbXNvbm9ybWFsIj58IDxhIGhyZWY9Imh0dHBzOi8vbmFtMDYuc2FmZWxp bmtzLnByb3RlY3Rpb24ub3V0bG9vay5jb20vP3VybD1odHRwJTNBJTJGJTJGZHJldC5uZXQlMkZu ZXRkcmV0JmFtcDtkYXRhPTAyJTdDMDElN0NkdGhhbGVyJTQwbWljcm9zb2Z0LmNvbSU3Q2IxMTVj N2Y4YzcwYjQxMGViOTgzMDhkODAyYTBhOGY0JTdDNzJmOTg4YmY4NmYxNDFhZjkxYWIyZDdjZDAx MWRiNDclN0MxJTdDMCU3QzYzNzI2MjIzNjMzOTIxNDE1MCZhbXA7c2RhdGE9aHE4UVZEclh4Um1W M2lTNkRGN1IlMkZlWEZ0REtudE1jWU9IbkxTTXF4NXpvJTNEJmFtcDtyZXNlcnZlZD0wIiB0YXJn ZXQ9Il9ibGFuayI+DQpodHRwOi8vZHJldC5uZXQvbmV0ZHJldDwvYT4gfDxvOnA+PC9vOnA+PC9w Pg0KPC9kaXY+DQo8ZGl2Pg0KPHAgY2xhc3M9Im94LTRmNmY3YWFlNzktbXNvbm9ybWFsIj58IDxh IGhyZWY9Imh0dHBzOi8vbmFtMDYuc2FmZWxpbmtzLnByb3RlY3Rpb24ub3V0bG9vay5jb20vP3Vy bD1odHRwJTNBJTJGJTJGdHdpdHRlci5jb20lMkZkcmV0JmFtcDtkYXRhPTAyJTdDMDElN0NkdGhh bGVyJTQwbWljcm9zb2Z0LmNvbSU3Q2IxMTVjN2Y4YzcwYjQxMGViOTgzMDhkODAyYTBhOGY0JTdD NzJmOTg4YmY4NmYxNDFhZjkxYWIyZDdjZDAxMWRiNDclN0MxJTdDMCU3QzYzNzI2MjIzNjMzOTIy NDEwNSZhbXA7c2RhdGE9OVY1bDJjZ3lnTEYyR0piVDlFaDBwdGQybXY0WVJidlptNm9hWVNyZjhm RSUzRCZhbXA7cmVzZXJ2ZWQ9MCIgdGFyZ2V0PSJfYmxhbmsiPg0KaHR0cDovL3R3aXR0ZXIuY29t L2RyZXQ8L2E+IHw8bzpwPjwvbzpwPjwvcD4NCjwvZGl2Pg0KPC9ibG9ja3F1b3RlPg0KPC9kaXY+ DQo8L2Jsb2NrcXVvdGU+DQo8ZGl2Pg0KPHAgY2xhc3M9Ik1zb05vcm1hbCI+PGJyPg0KJm5ic3A7 IDxvOnA+PC9vOnA+PC9wPg0KPC9kaXY+DQo8L2Rpdj4NCjwvYm9keT4NCjwvaHRtbD4NCg== --_000_BL0PR2101MB10278A5360398EFF2E73FC0BA38E0BL0PR2101MB1027_-- From nobody Wed May 27 18:06:16 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 3517A3A041E for ; Wed, 27 May 2020 18:06:14 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.694 X-Spam-Level: X-Spam-Status: No, score=-1.694 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, HTML_MESSAGE=0.001, HTTPS_HTTP_MISMATCH=0.1, MIME_HTML_ONLY=0.1, RCVD_IN_DNSWL_BLOCKED=0.001, RCVD_IN_MSPIKE_H3=0.001, RCVD_IN_MSPIKE_WL=0.001, SPF_NONE=0.001, URIBL_BLOCKED=0.001] autolearn=no autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id lqTAg0fDChrU for ; Wed, 27 May 2020 18:06:12 -0700 (PDT) Received: from mout.perfora.net (mout.perfora.net [74.208.4.194]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id A47243A03F7 for ; Wed, 27 May 2020 18:06:12 -0700 (PDT) Received: from oxusgaltgw10.schlund.de ([10.72.72.56]) by mrelay.perfora.net (mreueus003 [74.208.5.2]) with ESMTPSA (Nemesis) id 0MeyVz-1jOW5r2VWj-00OXB1; Thu, 28 May 2020 03:06:10 +0200 Date: Wed, 27 May 2020 21:06:10 -0400 (EDT) From: Timothy Mcsweeney Reply-To: Timothy Mcsweeney To: Dave Thaler , uri-review@ietf.org Message-ID: <117630321.142251.1590627970509@email.ionos.com> In-Reply-To: References: <491516506.246380.1589851279474@email.ionos.com> <5EC9B257.31362.CC5E003@dan.tobias.name> <1783049000.100771.1590323508943@email.ionos.com> <5ECA8A94.23977.101292FE@dan.tobias.name> <1426881880.158099.1590335585858@email.ionos.com> <94368b41-c15b-da2c-421d-fdd9300be6e9@dret.net> <1310141163.159340.1590344745080@email.ionos.com> <1081815563.141711.1590624311343@email.ionos.com> MIME-Version: 1.0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-Priority: 3 Importance: Normal X-Mailer: Open-Xchange Mailer v7.10.1-Rev31 X-Originating-Client: open-xchange-appsuite X-Provags-ID: V03:K1:aRjjGBENI+/oRy6UZd6X3yKdysxBDFytHMg99GQhOTrwNW2x4fd mBpZUYitt6Au9M5VzdEcweZ2GwBq2dXKoCkc2WoOai3ms3iTXYP6PNwE0p8a0luv0jbcC6f RD2VNcP6TiZs7WxpT/sa+0f3+/bzISsoSmwLPsu4rEuIeKO49ffqbeRf9RnmdFDkGbHPVmr 3nbDK1tAgFbKtOS8MEvqQ== X-UI-Out-Filterresults: notjunk:1;V03:K0:vdZ8ELfWl0M=:dXOldalKN3tsxnSNY/gba6 VwafSWo7s5DG0qb8NBnRPM8shY6Z3nRgoA234efrVr5xryh/NMrBLB71PltA50djN36sZBy8R 26t9k/3XUnvyrkW/2NQc/WX42EzWZ5C+3Wbd01rD7+OoQXLoWAP2UMZ1RTcslNFmmqNX3cQap /uuFj4+rNtB9e5xqjsZccem2QULiVmz+tvsA/S3Az4tLvBDk6YtBw73vzfLGKQAk/vRWc3+B+ v7oOYGU6BID/+qgN1SAMGqlQy+PtUu1CtzuIVTyAED+4EZ9s3dqFWrjPVUUi9F+l2iuUENOI3 RcY13pYdcn2QDbLTx2DoCcgV5ZS8iiOdSJiftp4tMdsFrGyHgOs+ws/7CwIYic4/TfgsDPXMj fGGo2uX59TTsrOCOTJZ3TwzEDfh+MbLZKzg0id889XDNeXQXI7PGbWqS5IJOyC/5evUZQv1JZ v5g1ILMjte3TFraJdaisbqRFj4Cby54s+vg3iZPt3yryII7OSGr7Dt9/MZTkM1ES0+LcymvHc GAaFJjwks/rNtzMTcpIeAXVgyG6mexedG219vAcv96GP9RQ76Bv6u4ac1Yzrx2mhGgThw/FZv FAcrea5F45iBQr6b736T31WI+Ud0XtW1ko1AgOBImFu7qB9hMO69/izI4TwYlN3JUIynIiC/j RL+VV2zXhMZ8AEdDxfPDGTkK1B1oof176IyuyP7VEQ8rCMwtTqMxr4X+qH4z713NgsRPPpmvR zLiSH5gCYQ9+sO1Ghv7Yn/+NqPm+w8oJOT7FZg3GLQZum5TblAgyAg4n2ur4/7XB26V3pFnn3 JiPaOzqAxWmsC3EneKCIUdMGeYhQnZ9mZIN07wtz7snIbDTvI2vzyzsTXq7upGLVKP+Zq+t Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 28 May 2020 01:06:14 -0000 =20 =20
Hi Dave, 

By "safe" I meant like ".....
safe to be
   used by scheme-specific and producer-specific algorithms for
   delimiting data subcomponents within a URI"

Like it says in secti= on 2.2 of RFC3986.

Tim

On May 27, 2020 at 8:48 PM Dave Thaler <dthaler@microsoft.com> wro= te:=20

s/URL/URI/ in both case= s in my response J

 

From: Uri-review &= lt;uri-review-bounces@ietf.org> On Behalf Of Dave Thale= r
Sent: Wednesday, May 27, 2020 5:47 PM
To:<= /strong> Timothy Mcsweeney <tim@dropnumber.com>; uri-review@ietf.org<= br>Subject: Re: [Uri-review] Request for review


I don=E2=80=99t underst= and your question.   The URL syntax is fixed by that RFC. =

I don=E2=80=99t know wh= at you mean by =E2=80=9Csafe=E2=80=9D or =E2=80=9Cvalid=E2=80=9D.

 

If by =E2=80=9Cvalid=E2= =80=9D you mean =E2=80=9Callowed by RFC 3986=E2=80=9D, the answer is that t= hey may only appear in a URL literally

if they have the exact = meaning in the RFC, otherwise they must be pct-encoded.

 

 

From: Uri-review &= lt;uri-review-bounces@ietf.o= rg> On Behalf Of Timothy Mcsweeney
Sent:= Wednesday, May 27, 2020 5:05 PM
To: uri-review@ietf.org
Subject:= Re: [Uri-review] Request for review


Hi Dave, 


If the other six gen-delims from= the reserved set were safe and valid, would you oppose their use in URIs?<= /p>


Tim




= On May 24, 2020 at 6:08 PM Dave Thaler <dthaler@microsoft.com> wrote:

Hi Tim,=

  =

Correct= the colon is not part of the hier-part, the hier-part is what comes after = the colon.  RFC 3986 says:

  =

URI  &= nbsp;      =3D scheme ":" hier-part [ "?" query ] = [ "#" fragment ]

  =

Only st= rings that conform to the above are URIs.

So =E2= =80=9Cdrop#sd54g54=E2=80=9D is not a URI because it does not conform to the= above syntax, as it has no =E2=80=9C:=E2=80=9D

  =

=E2=80= =9Cdrop:sd54g54=E2=80=9D on the other hand would be a valid URI.

  =

This is= what folks are saying when they say if you just change the =E2=80=9C#=E2= =80=9D to a =E2=80=9C:=E2=80=9D in your draft then it becomes legal.

  =

Dave

  =

From:<= /strong> Uri-review <uri-revie= w-bounces@ietf.org> On Behalf Of Timothy Mcsweeney
Sent: Sunday, = May 24, 2020 11:26 AM
To: Erik Wilde <erik.wilde@dret.net>; uri-review@ietf.org
Subject: Re: [Uri-review] Request for review


Hi Erik, 


Thank you, I will= have another look at my reference to section 3.   

Would you agree t= hat in "https://ietf.org" the colon is not part of the hi= er-part? 

On May 24, 2020 = at 12:02 PM Erik Wilde < erik.wi= lde@dret.net> wrote:



hey tim.


On 2020-05-24 17= :53, Timothy Mcsweeney wrote:

Yes, I agree an= d understand that the same way as you.   But when the "#"

leaves the clie= nt it is not leaving as a fragment,

what people are = telling you is that "#" and anything following it never

leaves the clien= t, by definition..


it is leaving a= s a

way to separate= the URI components, <scheme> and <path> or for http it

would be separa= ting <scheme> and <authority>.  It is this that makes me

believe that ev= en if the colon is required for http resolution, it is

not necessarily= required for all URI.

this discussion = could be more productive if you had a brief look at the

specs you're dep= ending on. the very first rule shown in


URI =3D scheme "= :" hier-part [ "?" query ] [ "#" fragment ]


each URI is defi= ned like this and must have a colon.


cheers,


dret.


--

erik wilde | mai= lto: erik.wilde@dret.net |


 


 
=20 From nobody Fri May 29 03:02:02 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 5316D3A0D97 for ; Fri, 29 May 2020 03:02:00 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.895 X-Spam-Level: X-Spam-Status: No, score=-1.895 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_MSPIKE_H3=0.001, RCVD_IN_MSPIKE_WL=0.001, SPF_HELO_NONE=0.001, SPF_NONE=0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id wSSHne0bKrZF for ; Fri, 29 May 2020 03:01:57 -0700 (PDT) Received: from relay12.mail.ox.ac.uk (relay12.mail.ox.ac.uk [129.67.1.163]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 779123A0CA8 for ; Fri, 29 May 2020 03:01:57 -0700 (PDT) Received: from smtp5.mail.ox.ac.uk ([163.1.2.207]) by relay12.mail.ox.ac.uk with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.89) (envelope-from ) id 1jebpr-00009t-f5; Fri, 29 May 2020 11:01:55 +0100 Received: from gklyne38.plus.com ([81.174.129.24] helo=spare-94.atuin.ninebynine.org) by smtp5.mail.ox.ac.uk with esmtpsa (TLS1.2:ECDHE_RSA_AES_128_GCM_SHA256:128) (Exim 4.89) (envelope-from ) id 1jebpn-00085k-IC; Fri, 29 May 2020 11:01:51 +0100 To: Timothy Mcsweeney , uri-review@ietf.org References: <491516506.246380.1589851279474@email.ionos.com> <5EC9B257.31362.CC5E003@dan.tobias.name> <1783049000.100771.1590323508943@email.ionos.com> <5ECA8A94.23977.101292FE@dan.tobias.name> <1426881880.158099.1590335585858@email.ionos.com> <94368b41-c15b-da2c-421d-fdd9300be6e9@dret.net> <1310141163.159340.1590344745080@email.ionos.com> <1081815563.141711.1590624311343@email.ionos.com> <117630321.142251.1590627970509@email.ionos.com> From: Graham Klyne Message-ID: <8ae1641a-74c8-6c2d-7092-6cf53e745fb7@ninebynine.org> Date: Fri, 29 May 2020 11:01:48 +0100 User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.15; rv:68.0) Gecko/20100101 Thunderbird/68.8.0 MIME-Version: 1.0 In-Reply-To: <117630321.142251.1590627970509@email.ionos.com> Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-GB Content-Transfer-Encoding: 8bit X-Oxford-Username: zool0635 Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 29 May 2020 10:02:00 -0000 Hmmm... I find that bit of RFC3986 isn't immeditely clear. But on closer study, I think it's simply saying that the characters are "safe" in the sense that they are protected from change by URI normalization, hence that when used as delimiters there is no risk that the interpretation of the URI is affected by URI normalization (see also section 6 of RFC 3986). But some of these reserved characters already have defined purposes in URI structure, and any scheme-dependent use needs to take care not to interfere with such use. For example, using "#" as a delimiter within a URI path would interfere with it's already-defined purpose to delimit a fragment. Also, current URI structure *requires* that the ":" is used to delimit the scheme name from the rest of the URI. Suggestions by others on this list to use ":" rather than "#" are not entirely arbitrary. As a rule of thumb, I would suggest that if you do need scheme-specific delimiters (and it's not clear to me that you do), then using one from the "sub-delims" set is more likely to avoid conflicts with generic URI syntax and interpretation. #g -- On 28/05/2020 02:06, Timothy Mcsweeney wrote: > Hi Dave, > > By "safe" I meant like "..... > > safe to be > used by scheme-specific and producer-specific algorithms for > delimiting data subcomponents within a URI" > > Like it says in section 2.2 of RFC3986. > > Tim > >> On May 27, 2020 at 8:48 PM Dave Thaler wrote: >> >> s/URL/URI/ in both cases in my response J >> >> *From:*Uri-review *On Behalf Of *Dave Thaler >> *Sent:* Wednesday, May 27, 2020 5:47 PM >> *To:* Timothy Mcsweeney ; uri-review@ietf.org >> *Subject:* Re: [Uri-review] Request for review >> >> >> I don’t understand your question.   The URL syntax is fixed by that RFC. >> >> I don’t know what you mean by “safe” or “valid”. >> >> If by “valid” you mean “allowed by RFC 3986”, the answer is that they may only >> appear in a URL literally >> >> if they have the exact meaning in the RFC, otherwise they must be pct-encoded. >> >> *From:*Uri-review > > *On Behalf Of *Timothy Mcsweeney >> *Sent:* Wednesday, May 27, 2020 5:05 PM >> *To:* uri-review@ietf.org >> *Subject:* Re: [Uri-review] Request for review >> >> >> Hi Dave, >> >> >> If the other six gen-delims from the reserved set were safe and valid, would >> you oppose their use in URIs? >> >> >> Tim >> >> >> >> >> On May 24, 2020 at 6:08 PM Dave Thaler > > wrote: >> >> Hi Tim, >> >> Correct the colon is not part of the hier-part, the hier-part is what >> comes after the colon.  RFC 3986 says: >> >> URI         = scheme ":" hier-part [ "?" query ] [ "#" fragment ] >> >> Only strings that conform to the above are URIs. >> >> So “drop#sd54g54” is not a URI because it does not conform to the above >> syntax, as it has no “:” >> >> “drop:sd54g54” on the other hand would be a valid URI. >> >> This is what folks are saying when they say if you just change the “#” to >> a “:” in your draft then it becomes legal. >> >> Dave >> >> *From:*Uri-review > > *On Behalf Of *Timothy Mcsweeney >> *Sent:* Sunday, May 24, 2020 11:26 AM >> *To:* Erik Wilde >; >> uri-review@ietf.org >> *Subject:* Re: [Uri-review] Request for review >> >> >> Hi Erik, >> >> >> Thank you, I will have another look at my reference to section 3. >> >> Would you agree that in "https://ietf.org >> " >> the colon is not part of the hier-part? >> >> On May 24, 2020 at 12:02 PM Erik Wilde < erik.wilde@dret.net >> > wrote: >> >> >> >> hey tim. >> >> >> On 2020-05-24 17:53, Timothy Mcsweeney wrote: >> >> Yes, I agree and understand that the same way as you.   But when >> the "#" >> >> leaves the client it is not leaving as a fragment, >> >> what people are telling you is that "#" and anything following it never >> >> leaves the client, by definition.. >> >> >> it is leaving as a >> >> way to separate the URI components, and or for http it >> >> would be separating and .  It is this that >> makes me >> >> believe that even if the colon is required for http resolution, it is >> >> not necessarily required for all URI. >> >> this discussion could be more productive if you had a brief look at the >> >> specs you're depending on. the very first rule shown in >> >> https://tools.ietf.org/html/rfc3986#section-3 >> >> is >> >> >> URI = scheme ":" hier-part [ "?" query ] [ "#" fragment ] >> >> >> each URI is defined like this and must have a colon. >> >> >> cheers, >> >> >> dret. >> >> >> -- >> >> erik wilde | mailto: erik.wilde@dret.net | >> >> | http://dret.net/netdret >> >> | >> >> | http://twitter.com/dret >> >> | >> >> > > > _______________________________________________ > Uri-review mailing list > Uri-review@ietf.org > https://www.ietf.org/mailman/listinfo/uri-review > From nobody Fri May 29 09:46:18 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 9D1DA3A0DB0 for ; Fri, 29 May 2020 09:46:16 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.695 X-Spam-Level: X-Spam-Status: No, score=-1.695 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, HTML_MESSAGE=0.001, HTTP_ESCAPED_HOST=0.1, MIME_HTML_ONLY=0.1, RCVD_IN_MSPIKE_H3=0.001, RCVD_IN_MSPIKE_WL=0.001, SPF_NONE=0.001, URIBL_BLOCKED=0.001] autolearn=no autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id Y-oWbfe0GBgl for ; Fri, 29 May 2020 09:46:14 -0700 (PDT) Received: from mout.perfora.net (mout.perfora.net [74.208.4.194]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id D2A0A3A0C49 for ; Fri, 29 May 2020 09:46:13 -0700 (PDT) Received: from oxusgaltgw05.schlund.de ([10.72.72.51]) by mrelay.perfora.net (mreueus003 [74.208.5.2]) with ESMTPSA (Nemesis) id 0MFN9m-1jk9dl1BXI-00EPig; Fri, 29 May 2020 18:45:37 +0200 Date: Fri, 29 May 2020 12:45:37 -0400 (EDT) From: Timothy Mcsweeney Reply-To: Timothy Mcsweeney To: Graham Klyne , uri-review@ietf.org Message-ID: <797476254.282655.1590770737009@email.ionos.com> In-Reply-To: <8ae1641a-74c8-6c2d-7092-6cf53e745fb7@ninebynine.org> References: <491516506.246380.1589851279474@email.ionos.com> <5EC9B257.31362.CC5E003@dan.tobias.name> <1783049000.100771.1590323508943@email.ionos.com> <5ECA8A94.23977.101292FE@dan.tobias.name> <1426881880.158099.1590335585858@email.ionos.com> <94368b41-c15b-da2c-421d-fdd9300be6e9@dret.net> <1310141163.159340.1590344745080@email.ionos.com> <1081815563.141711.1590624311343@email.ionos.com> <117630321.142251.1590627970509@email.ionos.com> <8ae1641a-74c8-6c2d-7092-6cf53e745fb7@ninebynine.org> MIME-Version: 1.0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-Priority: 3 Importance: Normal X-Originating-Client: open-xchange-appsuite X-Mailer: Open-Xchange Mailer v7.10.1-Rev31 X-Provags-ID: V03:K1:j3ZaB5rfnjwCu0Dsw1fJ+am7PdLwDF3bDzAz1DSCzXUe5BRfo6x GmHaEqIgqP5nivQgQDE6EWqFnFXXsnlB6HEOOuktKZrNDcYVPkNi6DG2EOjaz/J42G/5tbg EN5wDxwqBAE5p5u46Yqg3cliNW9t5F4isktj8pHXGj3wHohgSFclhbMYE09rYmKLqZ7rhP4 p4poo+9j/CS2g21zi6b1A== X-UI-Out-Filterresults: notjunk:1;V03:K0:HstXAVOXYZg=:oW+PeKnog6n0Lon4LXJ02r A0PF5Sur3UkDyFKRSRmycluioRiUd72FGW8ZqBk9nhORsmfIpWfMUDsS6zQG3RADHx3+cvYX2 +19Vtrc5ft1yJNdZoXyGpjElNmmYQAcyZIAbB28TrWAoSmFNuNntNbWOpasWSe7WGnQPiyEPv 3v3fXNhFRDCOMG1sqoie0dzTw619noTSkIAvvoeRW4Ege/+s0Vp/m6+gauXg2iZkYoAOPoUpH 5+Xi2kul8R13CvrQnwoPYz0CwFDYUeeClHh5vaRlat605iJKKmiAvytOSpTbNUk+CaaZkdWgM 3ilYhkuC66M01Fd0aEDJqeJh/LUzNjHshQQSYst0vdxl2x7M9GYo1zzKSxx4cP4r2rDMyACUH mh7gsGRBc3oeseY66yM1uZcb/oKWdyK/lc+BsY7nEp9ihnJMvI9ovYGuIvSQlasYBttIbfp3Y UzIMIE+WZmqYk5T0rwdZyqFHvhVxSBnK/RpDqsoC+F7+IY2OlspOcVbiLQKCtMDDT2T3oOxAa I21WLxZ+8zgDNlR2+cb1Ub3ULJrql4Tgot9CH3y4p8iFkUErSltlMsEHwbfGY7ArJw++xuhAr Gn/hT5Y5JmmCQ01f7wJDgP6nJ/fjMLsQztOiAWMZwBqUhhJg4GEdtOn7Tjj5a8KAQNUZ9tAnd SdctzkSP099eOv9UrV3nY0IT8RCxdqCE/csp4s9UYq+YvHpdZXkJ8eucHk/2U1RrRa4s4JJ6A mStebRpF2RafmrM7DVy1l6d8u0dtekdSmYXh6WGDE+bOEr475Jttf0sJUvz+1BU3KnaO6BOkZ H+BbfxDxP/TzF3K7Vj5by6XkgXT7qeLDnBdaR716Tw9AX2Nir979SrF4+odmDPyPW3DYxXyOC x+vTRsboerFrUUKGrlXA== Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 29 May 2020 16:46:17 -0000 =20 =20
Hi Graham,

I would never treat suggestions from this list as arbitrary, quite the= contrary.  
I want to change the format of this reply just for a minute to exp= ress my deductions. 

This is an excerpt from the conversation in my head:


If you take away all the components and subcomponents of a URI, wh= at's leftover? 
The colon. 
And what governs the colon? 
The dereferencing algorithm. 
Does http use a colon in its dereferencing? 
It does. 
What about a URN? 
It does. 
FTP and Mailto? 
Yup the same. 
So If you change the colon to a number sign would you get them sam= e output?
Yes.
All of them? 
Yes.
Can you prove it?
Yes.  
Why do all the delimiters have quotes around them?
Because they are interchangeable.
Interchangeable everywhere?
No, just within the scope of their placement.  That's why URN= s can use a bunch of colons and not interfere with the first colon after th= e URN scheme name.
But it says the colon is required doesn't it?
I can not pinpoint the sentence that says that.
But section 3, the colon is in the generic syntax, you can see tha= t right?
Yes but the title of section 3 is "Syntax Components" and the colo= n is not a component. 
Wait, what does generic mean?
Not specific. 
So the generic syntax is not specific?
That's right.
So [RFC3986] is a specification that is defining something that is= not specific?
Yup, says it right there in the abstract.

From here my mental conversation took a left turn.  But I wan= ted to put this out here so that the members of this list didn't think my i= ntent was for purely self interest reasons but that we can all use what's h= ere. 
 
Tim

On May 29, 2020 at 6:01 AM Graham Klyne <=20 gk@ninebynine.org> wrote:


Hmmm... I find that bit of RFC3986 isn't immeditely clear. But on close= r study,
I think it's simply saying that the characters are "safe" in the sense = that
they are protected from change by URI normalization, hence that when us= ed as
delimiters there is no risk that the interpretation of the URI is affec= ted by
URI normalization (see also section 6 of RFC 3986).

But some of these reserved characters already have defined purposes in = URI
structure, and any scheme-dependent use needs to take care not to inter= fere with
such use. For example, using "#" as a delimiter within a URI path would
interfere with it's already-defined purpose to delimit a fragment.

Also, current URI structure *requires* that the ":" is used to delimit = the
scheme name from the rest of the URI. Suggestions by others on this lis= t to use
":" rather than "#" are not entirely arbitrary.

As a rule of thumb, I would suggest that if you do need scheme-specific
delimiters (and it's not clear to me that you do), then using one from = the
"sub-delims" set is more likely to avoid conflicts with generic URI syn= tax and
interpretation.

#g
--


On 28/05/2020 02:06, Timothy Mcsweeney wrote:
Hi Dave,

By "safe" I meant like ".....

safe to be
used by scheme-specific and producer-specific algorithms for
delimiting data subcomponents within a URI"

Like it says in section 2.2 of RFC3986.

Tim

On May 27, 2020 at 8:48 PM Dave Thaler <=20 dthaler@microsoft.com>= ; wrote:
>> s/URL/URI/ in both cases in my response J
>>
>> *From:*Uri-review <=20 uri-review-bounces@ietf.= org> *On Behalf Of *Dave Thaler
>> *Sent:* Wednesday, May 27, 2020 5:47 PM
>> *To:* Timothy Mcsweeney <=20 tim@dropnumber.com>;=20 uri-review@ietf.org
>> *Subject:* Re: [Uri-review] Request for review
>>
>>
>> I don=E2=80=99t understand your question.   The URL = syntax is fixed by that RFC.
>>
>> I don=E2=80=99t know what you mean by =E2=80=9Csafe=E2=80=9D o= r =E2=80=9Cvalid=E2=80=9D.
>>
>> If by =E2=80=9Cvalid=E2=80=9D you mean =E2=80=9Callowed by RFC= 3986=E2=80=9D, the answer is that they may only
>> appear in a URL literally
>>
>> if they have the exact meaning in the RFC, otherwise they must= be pct-encoded.
>>
>> *From:*Uri-review <=20 uri-review-bounces@ietf.= org
>> <mailto:=20 uri-review-bounces@ietf.= org>> *On Behalf Of *Timothy Mcsweeney
>> *Sent:* Wednesday, May 27, 2020 5:05 PM
>> *To:*=20 uri-review@ietf.org <mail= to:=20 uri-review@ietf.org>
>> *Subject:* Re: [Uri-review] Request for review
>>
>>
>> Hi Dave,
>>
>>
>> If the other six gen-delims from the reserved set were safe an= d valid, would
>> you oppose their use in URIs?
>>
>>
>> Tim
>>
>>
>>
>>
>> On May 24, 2020 at 6:08 PM Dave Thaler <=20 dthaler@microsoft.com
>> <mailto:=20 dthaler@microsoft.com>&= gt; wrote:
>>
>> Hi Tim,
>>
>> Correct the colon is not part of the hier-part, the hier-part = is what
>> comes after the colon.  RFC 3986 says:
>>
>> URI         =3D scheme= ":" hier-part [ "?" query ] [ "#" fragment ]
>>
>> Only strings that conform to the above are URIs.
>>
>> So =E2=80=9Cdrop#sd54g54=E2=80=9D is not a URI because it does= not conform to the above
>> syntax, as it has no =E2=80=9C:=E2=80=9D
>>
>> =E2=80=9Cdrop:sd54g54=E2=80=9D on the other hand would be a va= lid URI.
>>
>> This is what folks are saying when they say if you just change= the =E2=80=9C#=E2=80=9D to
>> a =E2=80=9C:=E2=80=9D in your draft then it becomes legal.
>>
>> Dave
>>
>> *From:*Uri-review <=20 uri-review-bounces@ietf.= org
>> <mailto:=20 uri-review-bounces@ietf.= org>> *On Behalf Of *Timothy Mcsweeney
>> *Sent:* Sunday, May 24, 2020 11:26 AM
>> *To:* Erik Wilde <=20 erik.wilde@dret.net <mail= to:=20 erik.wilde@dret.net>>;
>> *Subject:* Re: [Uri-review] Request for review
>>
>>
>> Hi Erik,
>>
>>
>> Thank you, I will have another look at my reference to section= 3.
>>
>> Would you agree that in "=20 https:/= /ietf.org
>> the colon is not part of the hier-part?
>>
>> <mailto:=20 erik.wilde@dret.net>> = wrote:
>>
>>
>>
>> hey tim.
>>
>>
>> On 2020-05-24 17:53, Timothy Mcsweeney wrote:
>>
>> Yes, I agree and understand that the same way as you.  &n= bsp;But when
>> the "#"
>>
>> leaves the client it is not leaving as a fragment,
>>
>> what people are telling you is that "#" and anything following= it never
>>
>> leaves the client, by definition..
>>
>>
>> it is leaving as a
>>
>> way to separate the URI components, <scheme> and <pat= h> or for http it
>>
>> would be separating <scheme> and <authority>. = ; It is this that
>> makes me
>>
>> believe that even if the colon is required for http resolution= , it is
>>
>> not necessarily required for all URI.
>>
>> this discussion could be more productive if you had a brief lo= ok at the
>>
>> specs you're depending on. the very first rule shown in
>>
>> is
>>
>>
>> URI =3D scheme ":" hier-part [ "?" query ] [ "#" fragment ]
>>
>>
>> each URI is defined like this and must have a colon.
>>
>>
>> cheers,
>>
>>
>> dret.
>>
>>
>> --
>>
>> erik wilde | mailto:=20 erik.wilde@dret.net <mail= to:=20 erik.wilde@dret.net> |
>>
>> |
>>
>> |
>>
>>

_______________________________________________
Uri-review mailing list
=20 From nobody Fri May 29 11:23:05 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id B2ACC3A0F29 for ; Fri, 29 May 2020 11:23:03 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -2.097 X-Spam-Level: X-Spam-Status: No, score=-2.097 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, DKIM_VALID_EF=-0.1, FREEMAIL_FROM=0.001, HTML_MESSAGE=0.001, SPF_HELO_NONE=0.001, SPF_PASS=-0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no Authentication-Results: ietfa.amsl.com (amavisd-new); dkim=pass (2048-bit key) header.d=gmail.com Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id XpxUN9AqwgX8 for ; Fri, 29 May 2020 11:23:01 -0700 (PDT) Received: from mail-ot1-x343.google.com (mail-ot1-x343.google.com [IPv6:2607:f8b0:4864:20::343]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id EEDAC3A0F30 for ; Fri, 29 May 2020 11:23:00 -0700 (PDT) Received: by mail-ot1-x343.google.com with SMTP id z3so2652903otp.9 for ; Fri, 29 May 2020 11:23:00 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=TUczH/I300sAbBEm2cqhJJLhv2AlaEq/Fcyr3/ak7Bg=; b=oiVZOfdvCSxLeWkuS5Fc+M/yRMrjTriCaqOmsGn91ZC+1VEtBlxwYxRL2HqX8vnL0R 3OTXs8oPnoKCwKtH95ng3dqYoaNSMNQSmn60SAa+ii1UFao09Vw4RIKnI8piOC7040Uh 7N/g3jzZAHJdbjhj5lQkGqbkB0xH9nvRHhXnAs9wsJJt0eBb+AxbtdtXEYteyi8uoaS5 FKLNPO6/bsg9PKJZHWW2zIOHizS/0Vft2rHlTO8DBC6eH2tYQ/qjKhmecG2NtU42vnH3 rj75WNOr5R7jCrKD7cBF44JQ1iYzGsQScJDHeglgB47jJHJ4xCkuwg4Pt9R1qzAmTtCF AvBw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=TUczH/I300sAbBEm2cqhJJLhv2AlaEq/Fcyr3/ak7Bg=; b=sKcYvs9/66enW8rGQP/jgWt3hfeTOBg+UwJ7UunIk4IvD2SGcgOdYfChZOmW1nxE1A gq5hRBHIDMGCAzPGP4kVSKORo/ajNKG5bwffJNMC3lGmi74qnMer0A5ws1kL4T4UNK7Y EWwIgxK7Q/3LVWlOLQItuNw9DXFT8iatxPoppuwM2rz9FKULWW5mWWRS9NgTve7bTu4T UyYbarR/FaZzHzq9j0kaZVceqcm6uLzIEPefqoooMv3EeO6ViTkiGcaBp2WJAYnIaDic 8fg7dJPtKRrwDyIExxknS+S//q+e5d3sYsF4yTU4gwUWStKui2jalWJvS7CrXnbR5hFv Pb+A== X-Gm-Message-State: AOAM530kmnd4rmokUYkSrtJtX7P/xlPDA7ZHqB9JEv/jkKOa68/xKi4N cBrVlg8TRgCgCtfNvMid1P0vDmZL5F0CMgTRhWM= X-Google-Smtp-Source: ABdhPJwwyIFZTBUu6d3cEJ/DfwUf720eX0iICXeJX7gaCIMhp9OVFHsac4vDLpveXRXrousNI8B0pktsu6qScdTBxxY= X-Received: by 2002:a9d:5c09:: with SMTP id o9mr7276483otk.165.1590776580132; Fri, 29 May 2020 11:23:00 -0700 (PDT) MIME-Version: 1.0 References: <491516506.246380.1589851279474@email.ionos.com> <5EC9B257.31362.CC5E003@dan.tobias.name> <1783049000.100771.1590323508943@email.ionos.com> <5ECA8A94.23977.101292FE@dan.tobias.name> <1426881880.158099.1590335585858@email.ionos.com> <94368b41-c15b-da2c-421d-fdd9300be6e9@dret.net> <1310141163.159340.1590344745080@email.ionos.com> <1081815563.141711.1590624311343@email.ionos.com> <117630321.142251.1590627970509@email.ionos.com> <8ae1641a-74c8-6c2d-7092-6cf53e745fb7@ninebynine.org> <797476254.282655.1590770737009@email.ionos.com> In-Reply-To: <797476254.282655.1590770737009@email.ionos.com> From: Ted Hardie Date: Fri, 29 May 2020 11:22:33 -0700 Message-ID: To: Timothy Mcsweeney Cc: Graham Klyne , uri-review@ietf.org Content-Type: multipart/alternative; boundary="000000000000f9d35805a6cd8858" Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 29 May 2020 18:23:04 -0000 --000000000000f9d35805a6cd8858 Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable Hi Tim, Thanks for sharing your thoughts on this. Let me suggest a slightly different formulation, which is not based on the colon itself, but on the scheme. The scheme indicates which type of URI a particular example is and thus governs a bunch of the behavior you describe below (whether it is used to dereference resources and, if so, what protocol(s) are used, if there are specific parameters and, if so, whether any are mandatory, and so on). For a URI parser, the method used to identify the scheme within any example is basically: "it's the bit to the left of the colon". If you don't have that specific marker, then a standard URI parser won't find a scheme and thus won't know what behavior to match to the example. A common early metaphor for this was to identify the network retrieval protocols as different parts of the plumbing of the Web, with the scheme names as the labels on the taps. That plumbing metaphor doesn't really work with abstract identifiers and is stretched by schemes like HTTPS which might have more than one set of underlying protocols. But the labeling still does--you can think of the schemes and the labels that tell the API which branch of behavior to invoke. The colon is the "end of label" marker, and that's why folks are insisting on it here; without it, you can't use the URI API to select a branch. best regards, Ted On Fri, May 29, 2020 at 9:46 AM Timothy Mcsweeney wrote: > Hi Graham, > > I would never treat suggestions from this list as arbitrary, quite the > contrary. > I want to change the format of this reply just for a minute to express my > deductions. > > This is an excerpt from the conversation in my head: > > > If you take away all the components and subcomponents of a URI, what's > leftover? > The colon. > And what governs the colon? > The dereferencing algorithm. > Does http use a colon in its dereferencing? > It does. > What about a URN? > It does. > FTP and Mailto? > Yup the same. > So If you change the colon to a number sign would you get them same > output? > Yes. > All of them? > Yes. > Can you prove it? > Yes. > Why do all the delimiters have quotes around them? > Because they are interchangeable. > Interchangeable everywhere? > No, just within the scope of their placement. That's why URNs can use a > bunch of colons and not interfere with the first colon after the URN sche= me > name. > But it says the colon is required doesn't it? > I can not pinpoint the sentence that says that. > But section 3, the colon is in the generic syntax, you can see that right= ? > Yes but the title of section 3 is "Syntax Components" and the colon is no= t > a component. > Wait, what does generic mean? > Not specific. > So the generic syntax is not specific? > That's right. > So [RFC3986] is a specification that is defining something that is not > specific? > Yup, says it right there in the abstract. > > From here my mental conversation took a left turn. But I wanted to put > this out here so that the members of this list didn't think my intent was > for purely self interest reasons but that we can all use what's here. > > Tim > > On May 29, 2020 at 6:01 AM Graham Klyne < gk@ninebynine.org> wrote: > > > Hmmm... I find that bit of RFC3986 isn't immeditely clear. But on closer > study, > I think it's simply saying that the characters are "safe" in the sense > that > they are protected from change by URI normalization, hence that when used > as > delimiters there is no risk that the interpretation of the URI is affecte= d > by > URI normalization (see also section 6 of RFC 3986). > > But some of these reserved characters already have defined purposes in UR= I > structure, and any scheme-dependent use needs to take care not to > interfere with > such use. For example, using "#" as a delimiter within a URI path would > interfere with it's already-defined purpose to delimit a fragment. > > Also, current URI structure *requires* that the ":" is used to delimit th= e > scheme name from the rest of the URI. Suggestions by others on this list > to use > ":" rather than "#" are not entirely arbitrary. > > As a rule of thumb, I would suggest that if you do need scheme-specific > delimiters (and it's not clear to me that you do), then using one from th= e > "sub-delims" set is more likely to avoid conflicts with generic URI synta= x > and > interpretation. > > #g > -- > > > On 28/05/2020 02:06, Timothy Mcsweeney wrote: > > Hi Dave, > > By "safe" I meant like "..... > > safe to be > used by scheme-specific and producer-specific algorithms for > delimiting data subcomponents within a URI" > > Like it says in section 2.2 of RFC3986. > > Tim > > On May 27, 2020 at 8:48 PM Dave Thaler < dthaler@microsoft.com> wrote: > > >> s/URL/URI/ in both cases in my response J > >> > >> *From:*Uri-review < uri-review-bounces@ietf.org> *On Behalf Of *Dave > Thaler > >> *Sent:* Wednesday, May 27, 2020 5:47 PM > >> *To:* Timothy Mcsweeney < tim@dropnumber.com>; uri-review@ietf.org > >> *Subject:* Re: [Uri-review] Request for review > >> > >> > >> I don=E2=80=99t understand your question. The URL syntax is fixed by= that > RFC. > >> > >> I don=E2=80=99t know what you mean by =E2=80=9Csafe=E2=80=9D or =E2=80= =9Cvalid=E2=80=9D. > >> > >> If by =E2=80=9Cvalid=E2=80=9D you mean =E2=80=9Callowed by RFC 3986=E2= =80=9D, the answer is that they > may only > >> appear in a URL literally > >> > >> if they have the exact meaning in the RFC, otherwise they must be > pct-encoded. > >> > >> *From:*Uri-review < uri-review-bounces@ietf.org > >> > *On Behalf Of *Timothy > Mcsweeney > >> *Sent:* Wednesday, May 27, 2020 5:05 PM > >> *To:* uri-review@ietf.org > >> *Subject:* Re: [Uri-review] Request for review > >> > >> > >> Hi Dave, > >> > >> > >> If the other six gen-delims from the reserved set were safe and valid, > would > >> you oppose their use in URIs? > >> > >> > >> Tim > >> > >> > >> > >> > >> On May 24, 2020 at 6:08 PM Dave Thaler < dthaler@microsoft.com > >> > wrote: > >> > >> Hi Tim, > >> > >> Correct the colon is not part of the hier-part, the hier-part is what > >> comes after the colon. RFC 3986 says: > >> > >> URI =3D scheme ":" hier-part [ "?" query ] [ "#" fragment ] > >> > >> Only strings that conform to the above are URIs. > >> > >> So =E2=80=9Cdrop#sd54g54=E2=80=9D is not a URI because it does not con= form to the above > >> syntax, as it has no =E2=80=9C:=E2=80=9D > >> > >> =E2=80=9Cdrop:sd54g54=E2=80=9D on the other hand would be a valid URI. > >> > >> This is what folks are saying when they say if you just change the =E2= =80=9C#=E2=80=9D > to > >> a =E2=80=9C:=E2=80=9D in your draft then it becomes legal. > >> > >> Dave > >> > >> *From:*Uri-review < uri-review-bounces@ietf.org > >> > *On Behalf Of *Timothy > Mcsweeney > >> *Sent:* Sunday, May 24, 2020 11:26 AM > >> *To:* Erik Wilde < erik.wilde@dret.net >; > >> uri-review@ietf.org > >> *Subject:* Re: [Uri-review] Request for review > >> > >> > >> Hi Erik, > >> > >> > >> Thank you, I will have another look at my reference to section 3. > >> > >> Would you agree that in " https://ietf.org > >> < "" rel=3D"noopener" > target=3D"_blank">https://nam06.safelinks.protection.outlook.com/?url=3Dh= ttps%3A%2F%2Fietf.org%2F&data=3D02%7C01%7Cdthaler%40microsoft.com%7Cb115c7f= 8c70b410eb98308d802a0a8f4%7C72f988bf86f141af91ab2d7cd011db47%7C1%7C0%7C6372= 62236339204192&sdata=3DUJ7TQnKfGZMnWkBKZCVozZQhn%2BGir1saiPQoNGV2C9M%3D&res= erved=3D0>" > >> the colon is not part of the hier-part? > >> > >> On May 24, 2020 at 12:02 PM Erik Wilde < erik.wilde@dret.net > >> > wrote: > >> > >> > >> > >> hey tim. > >> > >> > >> On 2020-05-24 17:53, Timothy Mcsweeney wrote: > >> > >> Yes, I agree and understand that the same way as you. But when > >> the "#" > >> > >> leaves the client it is not leaving as a fragment, > >> > >> what people are telling you is that "#" and anything following it neve= r > >> > >> leaves the client, by definition.. > >> > >> > >> it is leaving as a > >> > >> way to separate the URI components, and or for http it > >> > >> would be separating and . It is this that > >> makes me > >> > >> believe that even if the colon is required for http resolution, it is > >> > >> not necessarily required for all URI. > >> > >> this discussion could be more productive if you had a brief look at th= e > >> > >> specs you're depending on. the very first rule shown in > >> > >> https://tools.ietf.org/html/rfc3986#section-3 > >> < > https://nam06.safelinks.protection.outlook.com/?url=3Dhttps%3A%2F%2Ftools= .ietf..org%2Fhtml%2Frfc3986%23section-3&data=3D02%7C01%7Cdthaler%40microsof= t.com%7Cb115c7f8c70b410eb98308d802a0a8f4%7C72f988bf86f141af91ab2d7cd011db47= %7C1%7C0%7C637262236339214150&sdata=3DupZbOkALJ8SuEk%2FpLLqhdDDUNMhdpSmjWqp= MAyITzc8%3D&reserved=3D0 > > > > >> is > >> > >> > >> URI =3D scheme ":" hier-part [ "?" query ] [ "#" fragment ] > >> > >> > >> each URI is defined like this and must have a colon. > >> > >> > >> cheers, > >> > >> > >> dret. > >> > >> > >> -- > >> > >> erik wilde | mailto: erik.wilde@dret.net > | > >> > >> | http://dret.net/netdret > >> < > https://nam06.safelinks.protection.outlook.com/?url=3Dhttp%3A%2F%2Fdret.n= et%2Fnetdret&data=3D02%7C01%7Cdthaler%40microsoft.com%7Cb115c7f8c70b410eb98= 308d802a0a8f4%7C72f988bf86f141af91ab2d7cd011db47%7C1%7C0%7C6372622363392141= 50&sdata=3Dhq8QVDrXxRmV3iS6DF7R%2FeXFtDKntMcYOHnLSMqx5zo%3D&reserved=3D0 > = > > > >> | > >> > >> | http://twitter.com/dret > >> < > https://nam06.safelinks.protection.outlook.com/?url=3Dhttp%3A%2F%2Ftwitte= r.com%2Fdret&data=3D02%7C01%7Cdthaler%40microsoft.com%7Cb115c7f8c70b410eb98= 308d802a0a8f4%7C72f988bf86f141af91ab2d7cd011db47%7C1%7C0%7C6372622363392241= 05&sdata=3D9V5l2cgygLF2GJbT9Eh0ptd2mv4YRbvZm6oaYSrf8fE%3D&reserved=3D0 > > > > >> | > >> > >> > > > _______________________________________________ > Uri-review mailing list > Uri-review@ietf.org > https://www.ietf.org/mailman/listinfo/uri-review > > _______________________________________________ > Uri-review mailing list > Uri-review@ietf.org > https://www.ietf.org/mailman/listinfo/uri-review > --000000000000f9d35805a6cd8858 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
Hi Tim,

Thanks for sharing y= our thoughts on this.=C2=A0 Let me suggest a slightly different formulation= , which is not based on the colon itself, but on the scheme.=C2=A0

The scheme indicates which type of URI a particular= =C2=A0 example is and thus governs a bunch of the behavior you describe bel= ow (whether it is used to dereference resources and, if so, what protocol(s= ) are used, if there are specific parameters and, if so, whether any are ma= ndatory, and so on).=C2=A0 For a URI parser, the method used to identify th= e scheme within any example is basically: "it's the bit to the lef= t of the colon".=C2=A0 If you don't have that specific marker, the= n a standard URI parser won't find a scheme and thus won't know wha= t behavior to match to the example.=C2=A0

A c= ommon early metaphor for this was to identify the network retrieval protoco= ls as different parts of the plumbing of the Web, with the scheme names as = the labels on the taps.=C2=A0 That plumbing metaphor doesn't really wor= k with abstract identifiers and is stretched by schemes like HTTPS which mi= ght have more than one set of underlying protocols.=C2=A0 But the labeling = still does--you can think of the schemes and the labels that tell the API w= hich branch of behavior to invoke.=C2=A0 The colon is the "end of labe= l" marker, and that's why folks are insisting on it here; without = it, you can't use the URI API to select a branch.

best regards,

Ted

=

=20 =20 =20
Hi Graham,

I would never treat suggestions from this list as arbitrary, quite the= contrary.=C2=A0=C2=A0
I want to change the format of this reply just for a minute to exp= ress my deductions.=C2=A0

This is an excerpt from the conversation in my head:


If you take away all the components and subcomponents of a URI, wh= at's leftover?=C2=A0
The colon.=C2=A0
And what governs the colon?=C2=A0
The dereferencing algorithm.=C2=A0
Does http use a colon in its dereferencing?=C2=A0
It does.=C2=A0
What about a URN?=C2=A0
It does.=C2=A0
FTP and Mailto?=C2=A0
Yup the same.=C2=A0
So If you change the colon to a number sign would you get them sam= e output?
Yes.
All of them?=C2=A0
Yes.
Can you prove it?
Yes.=C2=A0=C2=A0
Why do all the delimiters have quotes around them?
Because they are interchangeable.
Interchangeable everywhere?
No, just within the scope of their placement.=C2=A0 That's why= URNs can use a bunch of colons and not interfere with the first colon afte= r the URN scheme name.
But it says the colon is required doesn't it?
I can not pinpoint the sentence that says that.
But section 3, the colon is in the generic syntax, you can see tha= t right?
Yes but the title of section 3 is "Syntax Components" an= d the colon is not a component.=C2=A0
Wait, what does generic mean?
Not specific.=C2=A0
So the generic syntax is not specific?
That's right.
So [RFC3986] is a specification that is defining something that is= not specific?
Yup, says it right there in the abstract.

From here my mental conversation took a left turn.=C2=A0 But I wan= ted to put this out here so that the members of this list didn't think = my intent was for purely self interest reasons but that we can all use what= 's here.=C2=A0
=C2=A0
Tim

On May 29, 2020 at 6:01 AM Graham Klyne <=20 gk@ninebynine.or= g> wrote:


Hmmm... I find that bit of RFC3986 isn't immeditely clear. But on c= loser study,
I think it's simply saying that the characters are "safe"= in the sense that
they are protected from change by URI normalization, hence that when us= ed as
delimiters there is no risk that the interpretation of the URI is affec= ted by
URI normalization (see also section 6 of RFC 3986).

But some of these reserved characters already have defined purposes in = URI
structure, and any scheme-dependent use needs to take care not to inter= fere with
such use. For example, using "#" as a delimiter within a URI = path would
interfere with it's already-defined purpose to delimit a fragment.

Also, current URI structure *requires* that the ":" is used t= o delimit the
scheme name from the rest of the URI. Suggestions by others on this lis= t to use
":" rather than "#" are not entirely arbitrary.

As a rule of thumb, I would suggest that if you do need scheme-specific
delimiters (and it's not clear to me that you do), then using one f= rom the
"sub-delims" set is more likely to avoid conflicts with gener= ic URI syntax and
interpretation.

#g
--


On 28/05/2020 02:06, Timothy Mcsweeney wrote:
Hi Dave,

By "safe" I meant like ".....

safe to be
used by scheme-specific and producer-specific algorithms for
delimiting data subcomponents within a URI"

Like it says in section 2.2 of RFC3986.

Tim

On May 27, 2020 at 8:48 PM Dave Thaler <=20 dthaler@mi= crosoft.com> wrote:
>> s/URL/URI/ in both cases in my response J
>>
>> *From:*Uri-review <=20 uri-re= view-bounces@ietf.org> *On Behalf Of *Dave Thaler
>> *Sent:* Wednesday, May 27, 2020 5:47 PM
>> *To:* Timothy Mcsweeney <=20 tim@dropnumber.= com>;=20 uri-review@iet= f.org
>> *Subject:* Re: [Uri-review] Request for review
>>
>>
>> I don=E2=80=99t understand your question.=C2=A0=C2=A0 The URL = syntax is fixed by that RFC.
>>
>> I don=E2=80=99t know what you mean by =E2=80=9Csafe=E2=80=9D o= r =E2=80=9Cvalid=E2=80=9D.
>>
>> If by =E2=80=9Cvalid=E2=80=9D you mean =E2=80=9Callowed by RFC= 3986=E2=80=9D, the answer is that they may only
>> appear in a URL literally
>>
>> if they have the exact meaning in the RFC, otherwise they must= be pct-encoded.
>>
>> *From:*Uri-review <=20 uri-re= view-bounces@ietf.org
>> <mailto:=20 uri-re= view-bounces@ietf.org>> *On Behalf Of *Timothy Mcsweeney
>> *Sent:* Wednesday, May 27, 2020 5:05 PM
>> *To:*=20 uri-review@iet= f.org <mailto:=20 uri-review@iet= f.org>
>> *Subject:* Re: [Uri-review] Request for review
>>
>>
>> Hi Dave,
>>
>>
>> If the other six gen-delims from the reserved set were safe an= d valid, would
>> you oppose their use in URIs?
>>
>>
>> Tim
>>
>>
>>
>>
>> On May 24, 2020 at 6:08 PM Dave Thaler <=20 dthaler@micr= osoft.com
>> <mailto:=20 dthaler@micr= osoft.com>> wrote:
>>
>> Hi Tim,
>>
>> Correct the colon is not part of the hier-part, the hier-part = is what
>> comes after the colon.=C2=A0 RFC 3986 says:
>>
>> URI=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 =3D scheme= ":" hier-part [ "?" query ] [ "#" fragment ]
>>
>> Only strings that conform to the above are URIs.
>>
>> So =E2=80=9Cdrop#sd54g54=E2=80=9D is not a URI because it does= not conform to the above
>> syntax, as it has no =E2=80=9C:=E2=80=9D
>>
>> =E2=80=9Cdrop:sd54g54=E2=80=9D on the other hand would be a va= lid URI.
>>
>> This is what folks are saying when they say if you just change= the =E2=80=9C#=E2=80=9D to
>> a =E2=80=9C:=E2=80=9D in your draft then it becomes legal.
>>
>> Dave
>>
>> *From:*Uri-review <=20 uri-re= view-bounces@ietf.org
>> <mailto:=20 uri-re= view-bounces@ietf.org>> *On Behalf Of *Timothy Mcsweeney
>> *Sent:* Sunday, May 24, 2020 11:26 AM
>> *To:* Erik Wilde <=20 erik.wilde@dre= t.net <mailto:=20 erik.wilde@dre= t.net>>;
>> *Subject:* Re: [Uri-review] Request for review
>>
>>
>> Hi Erik,
>>
>>
>> Thank you, I will have another look at my reference to section= 3.
>>
>> Would you agree that in "=20 https:/= /ietf.org
>> the colon is not part of the hier-part?
>>
>> On May 24, 2020 at 12:02 PM Erik Wilde <=20 erik.wilde@dre= t.net
>> <mailto:=20 erik.wilde@dre= t.net>> wrote:
>>
>>
>>
>> hey tim.
>>
>>
>> On 2020-05-24 17:53, Timothy Mcsweeney wrote:
>>
>> Yes, I agree and understand that the same way as you.=C2=A0 = =C2=A0But when
>> the "#"
>>
>> leaves the client it is not leaving as a fragment,
>>
>> what people are telling you is that "#" and anything= following it never
>>
>> leaves the client, by definition..
>>
>>
>> it is leaving as a
>>
>> way to separate the URI components, <scheme> and <pat= h> or for http it
>>
>> would be separating <scheme> and <authority>.=C2= =A0 It is this that
>> makes me
>>
>> believe that even if the colon is required for http resolution= , it is
>>
>> not necessarily required for all URI.
>>
>> this discussion could be more productive if you had a brief lo= ok at the
>>
>> specs you're depending on. the very first rule shown in
>>
>> is
>>
>>
>> URI =3D scheme ":" hier-part [ "?" query ]= [ "#" fragment ]
>>
>>
>> each URI is defined like this and must have a colon.
>>
>>
>> cheers,
>>
>>
>> dret.
>>
>>
>> --
>>
>> erik wilde | mailto:=20 erik.wilde@dre= t.net <mailto:=20 erik.wilde@dre= t.net> |
>>
>> |
>>
>> |
>>
>>

_______________________________________________
Uri-review mailing list
=20
_______________________________________________
Uri-review mailing list
Uri-review@ietf.or= g
https://www.ietf.org/mailman/listinfo/uri-review=
--000000000000f9d35805a6cd8858-- From nobody Fri May 29 11:54:51 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 252AB3A0ABA for ; Fri, 29 May 2020 11:54:50 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.798 X-Spam-Level: X-Spam-Status: No, score=-1.798 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, HTML_MESSAGE=0.001, MIME_HTML_ONLY=0.1, RCVD_IN_MSPIKE_H2=-0.001, SPF_NONE=0.001, URIBL_BLOCKED=0.001] autolearn=no autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id qpClAt29UM7Y for ; Fri, 29 May 2020 11:54:48 -0700 (PDT) Received: from mout.perfora.net (mout.perfora.net [74.208.4.196]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 4AB7C3A00C1 for ; Fri, 29 May 2020 11:54:48 -0700 (PDT) Received: from oxusgaltgw05.schlund.de ([10.72.72.51]) by mrelay.perfora.net (mreueus003 [74.208.5.2]) with ESMTPSA (Nemesis) id 0LxQZI-1ivAhZ2Zti-016uXh for ; Fri, 29 May 2020 20:54:47 +0200 Date: Fri, 29 May 2020 14:54:47 -0400 (EDT) From: Timothy Mcsweeney Reply-To: Timothy Mcsweeney To: uri-review@ietf.org Message-ID: <1729337515.289325.1590778487527@email.ionos.com> In-Reply-To: References: <491516506.246380.1589851279474@email.ionos.com> <5EC9B257.31362.CC5E003@dan.tobias.name> <1783049000.100771.1590323508943@email.ionos.com> <5ECA8A94.23977.101292FE@dan.tobias.name> <1426881880.158099.1590335585858@email.ionos.com> <94368b41-c15b-da2c-421d-fdd9300be6e9@dret.net> <1310141163.159340.1590344745080@email.ionos.com> <1081815563.141711.1590624311343@email.ionos.com> <117630321.142251.1590627970509@email.ionos.com> <8ae1641a-74c8-6c2d-7092-6cf53e745fb7@ninebynine.org> <797476254.282655.1590770737009@email.ionos.com> MIME-Version: 1.0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-Priority: 3 Importance: Normal X-Mailer: Open-Xchange Mailer v7.10.1-Rev31 X-Originating-Client: open-xchange-appsuite X-Provags-ID: V03:K1:C4HUh3uyyFKglaPySv29rQnAGz5qsv0Iuul4IOXpHGO8ptQGFWv kqrW/p4hyweIjawnTlZG10/Ze0Ow2rC6r42hl11d/RBTIvR82CG6BHU/xdeHadCjM5O7Q+R 0DY5sVuZiOTX4tM/+EjfJpWyoBcWW09nhgUc2DhD7meg4Gg5etsB3c+/0p4YZWLZ667ladP 4MYpyI2XMlhiPO3vR28mg== X-UI-Out-Filterresults: notjunk:1;V03:K0:5YDEwggRQSU=:f97BHSFr7BabCJvV+8lM3a jrR2q17cYkv0inLny7bzH82EguMec7zgLE8kAr0VgGicEkqCe7bC8EyoOWcwW7rY/zzytVozS +/uM7RO2Ww4bZ73nqJxRWK2iyh47HLwPA2wwKEYf9u877hYoFD7ll+agW5tfZCtp/Jrq54oiD KKD4VXzicEjOTBQnU2Fojz5Vo5CJm9nV+IIBPWdMAol9Crq35KD9gHm5HNVOTtElEZKdP5OXm +35viaa8XVvClaFflyyTznOD26JXfm3ydc2klfmDtvgK/m/EOqQsIlSjJAM8eVkD1ftMcBtk5 ZHrKnfCKJTngtOOSBemglhTCoYrBbQsmNo+WmYWCpER4n0uIuPmCjue7J6wkMlNMc9nG84/hY Ui7h6T0xuQjXJhf91ke9zgWYTHAs8r1zymVcO++pT1P98woQHHm1K7J3I14uWL+lSdsBBhFGd jfvthjS4PNYRlLUGFp43ccckhz4jJyfduEXPyXoapDzpsiGkLUZ8jZWcxxdht3LXmKVTUWs0O yQ4A64diBWr0NE51dw4PmaVIuf9+eLF3X27/J7MxawgiUKxVQnr8l2W87vES9l6VUIYgyblsd rUiB4IBNgeaad+EZlRvRyjeV6B8u0LQPzwi1Yd8XdaShA9bnG0V+jzQdZeBTWUNqfEX+niPwA Pt/3uq2KKtiIbk+Aq5PnmKDT35+zXaIu9LBXG2SxBZVZJGYR8kaqfpCw6zieTnaBN5+SEGFw9 wZqJ1EiA16nKpAn8ywXBbGi5wxZLDrJGNUKBvKdxP5ZkBimU992MdzjDUqnZibPjYyPiSS3Hh pPP2ivinAhnxuUAnA6qIvZYnqRa7dR3OdPGnfhJuJM8J+CUA1rmVmEo8En3pusg11oM4j2Y Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 29 May 2020 18:54:50 -0000 =20 =20
Hi Ted,
>For a URI parser, the method used to identify the scheme within any= example is basically: "it's the bit to the left of the colon".

Is it basically this, or exactly this?

> The colon is the "end of label" marker, and that's why folks are i= nsisting on it here; without it, you can't use the URI API to select a bran= ch

Is the colon the only "end of label" marker?

Tim
On May 29, 2020 at 2:22 PM Ted Hardie <ted.ietf@gmail.com> wrote:= =20

Hi Tim,

Thanks for sharing your thoughts on this.  Let me suggest a sligh= tly different formulation, which is not based on the colon itself, but on t= he scheme. =20

The scheme indicates which type of URI a particular  example is a= nd thus governs a bunch of the behavior you describe below (whether it is u= sed to dereference resources and, if so, what protocol(s) are used, if ther= e are specific parameters and, if so, whether any are mandatory, and so on)= .  For a URI parser, the method used to identify the scheme within any= example is basically: "it's the bit to the left of the colon".  If yo= u don't have that specific marker, then a standard URI parser won't find a = scheme and thus won't know what behavior to match to the example. =20

A common early metaphor for this was to identify the network retrieval= protocols as different parts of the plumbing of the Web, with the scheme n= ames as the labels on the taps.  That plumbing metaphor doesn't really= work with abstract identifiers and is stretched by schemes like HTTPS whic= h might have more than one set of underlying protocols.  But the label= ing still does--you can think of the schemes and the labels that tell the A= PI which branch of behavior to invoke.  The colon is the "end of label= " marker, and that's why folks are insisting on it here; without it, you ca= n't use the URI API to select a branch.=20

best regards,

Ted=20


On Fri, May 29, 2020 at 9:46 AM Timothy Mcsweeney <=20 tim@dropnumber.com> wrote= :=20
Hi Graham,

I would never treat suggestions from this list as arbitrary, quite= the contrary.  =20
I want to change the format of this reply just for a minute to= express my deductions. 

This is an excerpt from the conversation in my head:


If you take away all the components and subcomponents of a URI= , what's leftover? =20
The colon. =20
And what governs the colon? =20
The dereferencing algorithm. =20
Does http use a colon in its dereferencing? =20
It does. =20
What about a URN? =20
It does. =20
FTP and Mailto? =20
Yup the same. =20
So If you change the colon to a number sign would you get them= same output?=20
Yes.=20
All of them? =20
Yes.=20
Can you prove it?=20
Yes.  =20
Why do all the delimiters have quotes around them?=20
Because they are interchangeable.=20
Interchangeable everywhere?=20
No, just within the scope of their placement.  That's why= URNs can use a bunch of colons and not interfere with the first colon afte= r the URN scheme name.=20
But it says the colon is required doesn't it?=20
I can not pinpoint the sentence that says that.=20
But section 3, the colon is in the generic syntax, you can see= that right?=20
Yes but the title of section 3 is "Syntax Components" and the = colon is not a component. =20
Wait, what does generic mean?=20
Not specific. =20
So the generic syntax is not specific?=20
That's right.=20
So [RFC3986] is a specification that is defining something tha= t is not specific?=20
Yup, says it right there in the abstract.

From here my mental conversation took a left turn.  But I= wanted to put this out here so that the members of this list didn't think = my intent was for purely self interest reasons but that we can all use what= 's here. 

Tim

On May 29, 2020 at 6:01 AM Graham Klyne <=20 gk@ninebynine.org> wrote:


Hmmm... I find that bit of RFC3986 isn't immeditely clear. But on c= loser study,
I think it's simply saying that the characters are "safe" in the se= nse that
they are protected from change by URI normalization, hence that whe= n used as
delimiters there is no risk that the interpretation of the URI is a= ffected by
URI normalization (see also section 6 of RFC 3986).

But some of these reserved characters already have defined purposes= in URI
structure, and any scheme-dependent use needs to take care not to i= nterfere with
such use. For example, using "#" as a delimiter within a URI path w= ould
interfere with it's already-defined purpose to delimit a fragment.

Also, current URI structure *requires* that the ":" is used to deli= mit the
scheme name from the rest of the URI. Suggestions by others on this= list to use
":" rather than "#" are not entirely arbitrary.

As a rule of thumb, I would suggest that if you do need scheme-spec= ific
delimiters (and it's not clear to me that you do), then using one f= rom the
"sub-delims" set is more likely to avoid conflicts with generic URI= syntax and
interpretation.

#g
--


On 28/05/2020 02:06, Timothy Mcsweeney wrote:
Hi Dave,

By "safe" I meant like ".....

safe to be
used by scheme-specific and producer-specific algorithms for
delimiting data subcomponents within a URI"

Like it says in section 2.2 of RFC3986.

Tim

On May 27, 2020 at 8:48 PM Dave Thaler <=20 dthaler@microsoft.com> wrote:
>> s/URL/URI/ in both cases in my response J
>>
>> *From:*Uri-review <=20 uri-review-bounces@ietf.org> *On Behalf Of *Dave Thal= er
>> *Sent:* Wednesday, May 27, 2020 5:47 PM
>> *To:* Timothy Mcsweeney <=20 tim@dropnumber.com>;=20 uri-review@ietf.org
>> *Subject:* Re: [Uri-review] Request for review
>>
>>
>> I don=E2=80=99t understand your question.   The = URL syntax is fixed by that RFC.
>>
>> I don=E2=80=99t know what you mean by =E2=80=9Csafe=E2=80= =9D or =E2=80=9Cvalid=E2=80=9D.
>>
>> If by =E2=80=9Cvalid=E2=80=9D you mean =E2=80=9Callowed by= RFC 3986=E2=80=9D, the answer is that they may only
>> appear in a URL literally
>>
>> if they have the exact meaning in the RFC, otherwise they = must be pct-encoded.
>>
>> *From:*Uri-review <=20 uri-review-bounces@ietf.org
>> <mailto:=20 uri-review-bounces@ietf.org>> *On Behalf Of *Timot= hy Mcsweeney
>> *Sent:* Wednesday, May 27, 2020 5:05 PM
>> *To:*=20 uri-review@ietf.org <mailto:=20 uri-review@ietf.org>
>> *Subject:* Re: [Uri-review] Request for review
>>
>>
>> Hi Dave,
>>
>>
>> If the other six gen-delims from the reserved set were saf= e and valid, would
>> you oppose their use in URIs?
>>
>>
>> Tim
>>
>>
>>
>>
>> On May 24, 2020 at 6:08 PM Dave Thaler <=20 dthaler@microsoft.com
>> <mailto:=20 dthaler@microsoft.com>> wrote:
>>
>> Hi Tim,
>>
>> Correct the colon is not part of the hier-part, the hier-p= art is what
>> comes after the colon.  RFC 3986 says:
>>
>> URI         =3D sc= heme ":" hier-part [ "?" query ] [ "#" fragment ]
>>
>> Only strings that conform to the above are URIs.
>>
>> So =E2=80=9Cdrop#sd54g54=E2=80=9D is not a URI because it = does not conform to the above
>> syntax, as it has no =E2=80=9C:=E2=80=9D
>>
>> =E2=80=9Cdrop:sd54g54=E2=80=9D on the other hand would be = a valid URI.
>>
>> This is what folks are saying when they say if you just ch= ange the =E2=80=9C#=E2=80=9D to
>> a =E2=80=9C:=E2=80=9D in your draft then it becomes legal.
>>
>> Dave
>>
>> *From:*Uri-review <=20 uri-review-bounces@ietf.org
>> <mailto:=20 uri-review-bounces@ietf.org>> *On Behalf Of *Timot= hy Mcsweeney
>> *Sent:* Sunday, May 24, 2020 11:26 AM
>> *To:* Erik Wilde <=20 erik.wilde@dret.net <mailto:=20 erik.wilde@dret.net>>;
>> *Subject:* Re: [Uri-review] Request for review
>>
>>
>> Hi Erik,
>>
>>
>> Thank you, I will have another look at my reference to sec= tion 3.
>>
>> Would you agree that in "=20 htt= ps://ietf.org
>> the colon is not part of the hier-part?
>>
>> On May 24, 2020 at 12:02 PM Erik Wilde <=20 erik.wilde@dret.net
>> <mailto:=20 erik.wilde@dret.net>> wrote:
>>
>>
>>
>> hey tim.
>>
>>
>> On 2020-05-24 17:53, Timothy Mcsweeney wrote:
>>
>> Yes, I agree and understand that the same way as you. = ;  But when
>> the "#"
>>
>> leaves the client it is not leaving as a fragment,
>>
>> what people are telling you is that "#" and anything follo= wing it never
>>
>> leaves the client, by definition..
>>
>>
>> it is leaving as a
>>
>> way to separate the URI components, <scheme> and <= ;path> or for http it
>>
>> would be separating <scheme> and <authority>.&= nbsp; It is this that
>> makes me
>>
>> believe that even if the colon is required for http resolu= tion, it is
>>
>> not necessarily required for all URI.
>>
>> this discussion could be more productive if you had a brie= f look at the
>>
>> specs you're depending on. the very first rule shown in
>>
>> is
>>
>>
>> URI =3D scheme ":" hier-part [ "?" query ] [ "#" fragment = ]
>>
>>
>> each URI is defined like this and must have a colon.
>>
>>
>> cheers,
>>
>>
>> dret.
>>
>>
>> --
>>
>> erik wilde | mailto:=20 erik.wilde@dret.net <mailto:=20 erik.wilde@dret.net> |
>>
>> |
>>
>> |
>>
>>

_______________________________________________
Uri-review mailing list
_______________________________________________=20
Uri-review mailing list=20
Uri-review@ietf.org=20
https://www.ietf.org/mailman/listinfo/uri-review<= /a>=20

 
=20 From nobody Sat May 30 02:24:28 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id DC3063A07D1 for ; Sat, 30 May 2020 02:24:16 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.895 X-Spam-Level: X-Spam-Status: No, score=-1.895 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_MSPIKE_H3=0.001, RCVD_IN_MSPIKE_WL=0.001, SPF_HELO_NONE=0.001, SPF_NONE=0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id 1Yv7dHnheGuW for ; Sat, 30 May 2020 02:24:14 -0700 (PDT) Received: from relay12.mail.ox.ac.uk (relay12.mail.ox.ac.uk [129.67.1.163]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 1391C3A07CE for ; Sat, 30 May 2020 02:24:14 -0700 (PDT) Received: from smtp6.mail.ox.ac.uk ([163.1.2.206]) by relay12.mail.ox.ac.uk with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.89) (envelope-from ) id 1jexiu-00084O-e7; Sat, 30 May 2020 10:24:12 +0100 Received: from gklyne38.plus.com ([81.174.129.24] helo=spare-94.atuin.ninebynine.org) by smtp6.mail.ox.ac.uk with esmtpsa (TLS1.2:ECDHE_RSA_AES_128_GCM_SHA256:128) (Exim 4.89) (envelope-from ) id 1jexiu-0003ty-Jn; Sat, 30 May 2020 10:24:12 +0100 To: Timothy Mcsweeney , uri-review@ietf.org References: <491516506.246380.1589851279474@email.ionos.com> <5EC9B257.31362.CC5E003@dan.tobias.name> <1783049000.100771.1590323508943@email.ionos.com> <5ECA8A94.23977.101292FE@dan.tobias.name> <1426881880.158099.1590335585858@email.ionos.com> <94368b41-c15b-da2c-421d-fdd9300be6e9@dret.net> <1310141163.159340.1590344745080@email.ionos.com> <1081815563.141711.1590624311343@email.ionos.com> <117630321.142251.1590627970509@email.ionos.com> <8ae1641a-74c8-6c2d-7092-6cf53e745fb7@ninebynine.org> <797476254.282655.1590770737009@email.ionos.com> From: Graham Klyne Message-ID: <656ab4ec-df34-c7a4-ed36-79a03623636c@ninebynine.org> Date: Sat, 30 May 2020 10:24:11 +0100 User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.15; rv:68.0) Gecko/20100101 Thunderbird/68.8.0 MIME-Version: 1.0 In-Reply-To: <797476254.282655.1590770737009@email.ionos.com> Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-GB Content-Transfer-Encoding: 8bit X-Oxford-Username: zool0635 Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 30 May 2020 09:24:17 -0000 Hi Tim, A short answer here is that you need the colon after the scheme name because that's what the URI specification, which represents a community consensus, says. A pragmatic response is that many contexts allow either a URI or a relative reference to be used (e.g. HTML
). So it's important for a processor to be able to distinguish between these cases. The colon after the sceme name is what makes that possible (https://tools.ietf.org/html/rfc3986#section-4.1). (BTW, I wasn't suggesting you were treating anything as arbitrary. But in practice, some choices *are* arbitrary, and for interoperability we need to agree some such choices.) #g -- On 29/05/2020 17:45, Timothy Mcsweeney wrote: > Hi Graham, > > I would never treat suggestions from this list as arbitrary, quite the contrary. > I want to change the format of this reply just for a minute to express my > deductions. > > This is an excerpt from the conversation in my head: > > > If you take away all the components and subcomponents of a URI, what's leftover? > The colon. > And what governs the colon? > The dereferencing algorithm. > Does http use a colon in its dereferencing? > It does. > What about a URN? > It does. > FTP and Mailto? > Yup the same. > So If you change the colon to a number sign would you get them same output? > Yes. > All of them? > Yes. > Can you prove it? > Yes. > Why do all the delimiters have quotes around them? > Because they are interchangeable. > Interchangeable everywhere? > No, just within the scope of their placement.  That's why URNs can use a bunch > of colons and not interfere with the first colon after the URN scheme name. > But it says the colon is required doesn't it? > I can not pinpoint the sentence that says that. > But section 3, the colon is in the generic syntax, you can see that right? > Yes but the title of section 3 is "Syntax Components" and the colon is not a > component. > Wait, what does generic mean? > Not specific. > So the generic syntax is not specific? > That's right. > So [RFC3986] is a specification that is defining something that is not specific? > Yup, says it right there in the abstract. > > From here my mental conversation took a left turn.  But I wanted to put this > out here so that the members of this list didn't think my intent was for purely > self interest reasons but that we can all use what's here. > Tim > >> On May 29, 2020 at 6:01 AM Graham Klyne < gk@ninebynine.org >> > wrote: >> >> >> Hmmm... I find that bit of RFC3986 isn't immeditely clear. But on closer study, >> I think it's simply saying that the characters are "safe" in the sense that >> they are protected from change by URI normalization, hence that when used as >> delimiters there is no risk that the interpretation of the URI is affected by >> URI normalization (see also section 6 of RFC 3986). >> >> But some of these reserved characters already have defined purposes in URI >> structure, and any scheme-dependent use needs to take care not to interfere with >> such use. For example, using "#" as a delimiter within a URI path would >> interfere with it's already-defined purpose to delimit a fragment. >> >> Also, current URI structure *requires* that the ":" is used to delimit the >> scheme name from the rest of the URI. Suggestions by others on this list to use >> ":" rather than "#" are not entirely arbitrary. >> >> As a rule of thumb, I would suggest that if you do need scheme-specific >> delimiters (and it's not clear to me that you do), then using one from the >> "sub-delims" set is more likely to avoid conflicts with generic URI syntax and >> interpretation. >> >> #g >> -- >> >> >> On 28/05/2020 02:06, Timothy Mcsweeney wrote: >>> Hi Dave, >>> >>> By "safe" I meant like "..... >>> >>> safe to be >>> used by scheme-specific and producer-specific algorithms for >>> delimiting data subcomponents within a URI" >>> >>> Like it says in section 2.2 of RFC3986. >>> >>> Tim >>> >>>> On May 27, 2020 at 8:48 PM Dave Thaler < dthaler@microsoft.com >>>> > wrote: >> >> s/URL/URI/ in both cases in my response J >> >> >> >> *From:*Uri-review < uri-review-bounces@ietf.org >> > *On Behalf Of *Dave Thaler >> >> *Sent:* Wednesday, May 27, 2020 5:47 PM >> >> *To:* Timothy Mcsweeney < tim@dropnumber.com >; >> uri-review@ietf.org >> >> *Subject:* Re: [Uri-review] Request for review >> >> >> >> >> >> I don’t understand your question.   The URL syntax is fixed by that RFC. >> >> >> >> I don’t know what you mean by “safe” or “valid”. >> >> >> >> If by “valid” you mean “allowed by RFC 3986”, the answer is that they may only >> >> appear in a URL literally >> >> >> >> if they have the exact meaning in the RFC, otherwise they must be pct-encoded. >> >> >> >> *From:*Uri-review < uri-review-bounces@ietf.org >> >> >> >> >> *On Behalf Of *Timothy Mcsweeney >> >> *Sent:* Wednesday, May 27, 2020 5:05 PM >> >> *To:* uri-review@ietf.org > uri-review@ietf.org > >> >> *Subject:* Re: [Uri-review] Request for review >> >> >> >> >> >> Hi Dave, >> >> >> >> >> >> If the other six gen-delims from the reserved set were safe and valid, would >> >> you oppose their use in URIs? >> >> >> >> >> >> Tim >> >> >> >> >> >> >> >> >> >> On May 24, 2020 at 6:08 PM Dave Thaler < dthaler@microsoft.com >> >> >> >> wrote: >> >> >> >> Hi Tim, >> >> >> >> Correct the colon is not part of the hier-part, the hier-part is what >> >> comes after the colon.  RFC 3986 says: >> >> >> >> URI         = scheme ":" hier-part [ "?" query ] [ "#" fragment ] >> >> >> >> Only strings that conform to the above are URIs. >> >> >> >> So “drop#sd54g54” is not a URI because it does not conform to the above >> >> syntax, as it has no “:” >> >> >> >> “drop:sd54g54” on the other hand would be a valid URI. >> >> >> >> This is what folks are saying when they say if you just change the “#” to >> >> a “:” in your draft then it becomes legal. >> >> >> >> Dave >> >> >> >> *From:*Uri-review < uri-review-bounces@ietf.org >> >> >> >> >> *On Behalf Of *Timothy Mcsweeney >> >> *Sent:* Sunday, May 24, 2020 11:26 AM >> >> *To:* Erik Wilde < erik.wilde@dret.net >> >>; >> >> uri-review@ietf.org > uri-review@ietf.org > >> >> *Subject:* Re: [Uri-review] Request for review >> >> >> >> >> >> Hi Erik, >> >> >> >> >> >> Thank you, I will have another look at my reference to section 3. >> >> >> >> Would you agree that in " https://ietf.org >> >> < "" rel="noopener" >> target="_blank">https://nam06.safelinks.protection.outlook.com/?url=https%3A%2F%2Fietf.org%2F&data=02%7C01%7Cdthaler%40microsoft.com%7Cb115c7f8c70b410eb98308d802a0a8f4%7C72f988bf86f141af91ab2d7cd011db47%7C1%7C0%7C637262236339204192&sdata=UJ7TQnKfGZMnWkBKZCVozZQhn%2BGir1saiPQoNGV2C9M%3D&reserved=0>" >> >> >> the colon is not part of the hier-part? >> >> >> >> On May 24, 2020 at 12:02 PM Erik Wilde < erik.wilde@dret.net >> >> >> >> wrote: >> >> >> >> >> >> >> >> hey tim. >> >> >> >> >> >> On 2020-05-24 17:53, Timothy Mcsweeney wrote: >> >> >> >> Yes, I agree and understand that the same way as you.   But when >> >> the "#" >> >> >> >> leaves the client it is not leaving as a fragment, >> >> >> >> what people are telling you is that "#" and anything following it never >> >> >> >> leaves the client, by definition.. >> >> >> >> >> >> it is leaving as a >> >> >> >> way to separate the URI components, and or for http it >> >> >> >> would be separating and .  It is this that >> >> makes me >> >> >> >> believe that even if the colon is required for http resolution, it is >> >> >> >> not necessarily required for all URI. >> >> >> >> this discussion could be more productive if you had a brief look at the >> >> >> >> specs you're depending on. the very first rule shown in >> >> >> >> https://tools.ietf.org/html/rfc3986#section-3 >> >> < >> https://nam06.safelinks.protection.outlook.com/?url=https%3A%2F%2Ftools.ietf..org%2Fhtml%2Frfc3986%23section-3&data=02%7C01%7Cdthaler%40microsoft.com%7Cb115c7f8c70b410eb98308d802a0a8f4%7C72f988bf86f141af91ab2d7cd011db47%7C1%7C0%7C637262236339214150&sdata=upZbOkALJ8SuEk%2FpLLqhdDDUNMhdpSmjWqpMAyITzc8%3D&reserved=0> >> >> >> is >> >> >> >> >> >> URI = scheme ":" hier-part [ "?" query ] [ "#" fragment ] >> >> >> >> >> >> each URI is defined like this and must have a colon. >> >> >> >> >> >> cheers, >> >> >> >> >> >> dret. >> >> >> >> >> >> -- >> >> >> >> erik wilde | mailto: erik.wilde@dret.net >> > | >> >> >> >> | http://dret.net/netdret >> >> < >> https://nam06.safelinks.protection.outlook.com/?url=http%3A%2F%2Fdret.net%2Fnetdret&data=02%7C01%7Cdthaler%40microsoft.com%7Cb115c7f8c70b410eb98308d802a0a8f4%7C72f988bf86f141af91ab2d7cd011db47%7C1%7C0%7C637262236339214150&sdata=hq8QVDrXxRmV3iS6DF7R%2FeXFtDKntMcYOHnLSMqx5zo%3D&reserved=0> >> >> >> | >> >> >> >> | http://twitter.com/dret >> >> < >> https://nam06.safelinks.protection.outlook.com/?url=http%3A%2F%2Ftwitter.com%2Fdret&data=02%7C01%7Cdthaler%40microsoft.com%7Cb115c7f8c70b410eb98308d802a0a8f4%7C72f988bf86f141af91ab2d7cd011db47%7C1%7C0%7C637262236339224105&sdata=9V5l2cgygLF2GJbT9Eh0ptd2mv4YRbvZm6oaYSrf8fE%3D&reserved=0> >> >> >> | >> >> >> >> >>> >>> _______________________________________________ >>> Uri-review mailing list >>> Uri-review@ietf.org >>> https://www.ietf.org/mailman/listinfo/uri-review From nobody Sat May 30 05:21:00 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id B90B93A0A1C for ; Sat, 30 May 2020 05:20:57 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.695 X-Spam-Level: X-Spam-Status: No, score=-1.695 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, HTML_MESSAGE=0.001, HTTP_ESCAPED_HOST=0.1, MIME_HTML_ONLY=0.1, RCVD_IN_MSPIKE_H3=0.001, RCVD_IN_MSPIKE_WL=0.001, SPF_NONE=0.001, URIBL_BLOCKED=0.001] autolearn=no autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id Gfjm9b3qSU71 for ; Sat, 30 May 2020 05:20:55 -0700 (PDT) Received: from mout.perfora.net (mout.perfora.net [74.208.4.197]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id EB4723A0A1A for ; Sat, 30 May 2020 05:20:54 -0700 (PDT) Received: from oxusgaltgw03.schlund.de ([10.72.72.49]) by mrelay.perfora.net (mreueus002 [74.208.5.2]) with ESMTPSA (Nemesis) id 0MZBIA-1jQcqZ3FPQ-00L1Je; Sat, 30 May 2020 14:20:15 +0200 Date: Sat, 30 May 2020 08:20:15 -0400 (EDT) From: Timothy Mcsweeney Reply-To: Timothy Mcsweeney To: Graham Klyne , uri-review@ietf.org Message-ID: <1435838702.391137.1590841215132@email.ionos.com> In-Reply-To: <656ab4ec-df34-c7a4-ed36-79a03623636c@ninebynine.org> References: <491516506.246380.1589851279474@email.ionos.com> <5EC9B257.31362.CC5E003@dan.tobias.name> <1783049000.100771.1590323508943@email.ionos.com> <5ECA8A94.23977.101292FE@dan.tobias.name> <1426881880.158099.1590335585858@email.ionos.com> <94368b41-c15b-da2c-421d-fdd9300be6e9@dret.net> <1310141163.159340.1590344745080@email.ionos.com> <1081815563.141711.1590624311343@email.ionos.com> <117630321.142251.1590627970509@email.ionos.com> <8ae1641a-74c8-6c2d-7092-6cf53e745fb7@ninebynine.org> <797476254.282655.1590770737009@email.ionos.com> <656ab4ec-df34-c7a4-ed36-79a03623636c@ninebynine.org> MIME-Version: 1.0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-Priority: 3 Importance: Normal X-Mailer: Open-Xchange Mailer v7.10.1-Rev31 X-Originating-Client: open-xchange-appsuite X-Provags-ID: V03:K1:T9yonoRgRuidHnDM67h2uVzzeN3YlGmNspN+St3i/pkzGk7EEvg WfqA/55Odbhix7BYcPKrKIb1UjKUExQB5lfR0rdPgQ0JtFh+QXdHdYfyx8c/aGvfUF/BOEs gopXq2TG5QcbUn4poM/TZDomzSPC32tHJgnXfL9Kkjx/OSrSSV3r5qE4DNKjpqcHpMuZHAv 5cp9se8ZE3PW/VWgI8ILg== X-UI-Out-Filterresults: notjunk:1;V03:K0:34nTIojgEws=:RqXdfFl7fnrjjr8BJsSoc9 /o298dnDldYG4w6dE4ly8Fboso2rSZZuEB09www29cMymWCpjNva6byNHBvRC7YW+0wwCUi+j ODmKbQnYLLJXJUL3KPRqDjKrR6o7W8547jGe/2qAXaMYw2GCsmUd2c0FGFitNCVju1ttSOeWY 5ujayglfcdvbYK3KxbYYOIAbtx+NzJ6xlzIcS42KCwmv6Km/IiOr1InB6Q5pgXkqsO8xZZq/W IU6T/0MUuVR0Zw6Lg9QSJjYr+ukKHyVV6rV/G3CppFGq1b2xfwerRrJBU5+yOjcn/qslGUkjQ wAmfRRAJ4o7XX+5Wt5pgIqJcxAyG+0LItBnvbDkEcLXMB0fyp/zQcuhbEgo10P6FP03WuZPKX aP1QgIBT5X80NM+otK6oIQz8zqV1LHOg407CE2sIly/hDCGvl114JOhXFL7hjsMLALTIZBSBN cGtvtP6IHih0fbutfNcP/qakk97Frf4EKW53Wx9+ZMVDQGavPHVBgkiW1OBRuLKUbFCEO4wxG lZxmTsCZlMdM0uoYSJrC/GATPLbuEoRmz63VRKeOAd306gDMn8Gy3T5l/uSuKbv4ZlpTJhzhN Y66vdxFlPbxcTYL6CC8nLfs/jf9oHpzIylqVsYVCkSznyj8xMPsLIZ2eOFp/GXckXcHZcinLM 0VTIQujkAU//lC1EPmYnWGoD8Yl+BfivihJBvVBbXba5A5g9zG0IPG/uI/o0rE3ofHbYXT0ru fdrduL/aAvf24V3LmxrQyfQAF9V+o6YzXnN66o5PSuVHs5euRtOuZIMW5YirKKF4xewTSMWb4 RZ9rEADTq2EwZmlJdeEdfDRmHWd2a5ThZcJ2rD4VfAYrB6UQsL2AzlgDSZyrnKSvK2yJr4p2K eBPFSmOFAnrU5UTxYvMQ== Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 30 May 2020 12:20:58 -0000 =20 =20
Hi Graham, 

>>A short answer here is that you need the colon after the scheme= name
because that's what the URI specification, which represents a communit= y
consensus, says.

Yes, the entire 3986 represents a community consensus , even the p= arts some
don't like, including the parts I want to use. The community that rati= fied that
RFC still exists.

And if people want to make parsers that don't work with the spec it doe= sn't become the spec's problem.


Tim



Hi Tim,

A short answer here is that you need the colon after the scheme name be= cause
that's what the URI specification, which represents a community consens= us, says.

A pragmatic response is that many contexts allow either a URI or a rela= tive
reference to be used (e.g. HTML <a href=3D"...">). So it's import= ant for a
processor to be able to distinguish between these cases. The colon afte= r the
sceme name is what makes that possible

(BTW, I wasn't suggesting you were treating anything as arbitrary. But = in
practice, some choices *are* arbitrary, and for interoperability we nee= d to
agree some such choices.)

#g
--


On 29/05/2020 17:45, Timothy Mcsweeney wrote:
Hi Graham,

I would never treat suggestions from this list as arbitrary, quite the= contrary.
I want to change the format of this reply just for a minute to express= my
deductions.

This is an excerpt from the conversation in my head:


If you take away all the components and subcomponents of a URI, what's= leftover?
The colon.
And what governs the colon?
The dereferencing algorithm.
Does http use a colon in its dereferencing?
It does.
What about a URN?
It does.
FTP and Mailto?
Yup the same.
So If you change the colon to a number sign would you get them same ou= tput?
Yes.
All of them?
Yes.
Can you prove it?
Yes.
Why do all the delimiters have quotes around them?
Because they are interchangeable.
Interchangeable everywhere?
No, just within the scope of their placement.  That's why URNs ca= n use a bunch
of colons and not interfere with the first colon after the URN scheme = name.
But it says the colon is required doesn't it?
I can not pinpoint the sentence that says that.
But section 3, the colon is in the generic syntax, you can see that ri= ght?
Yes but the title of section 3 is "Syntax Components" and the colon is= not a
component.
Wait, what does generic mean?
Not specific.
So the generic syntax is not specific?
That's right.
So [RFC3986] is a specification that is defining something that is not= specific?
Yup, says it right there in the abstract.

From here my mental conversation took a left turn.  But I wanted = to put this
out here so that the members of this list didn't think my intent was f= or purely
self interest reasons but that we can all use what's here.
Tim

<mailto: gk@ninebynine.org>> wr= ote:
>>
>> Hmmm... I find that bit of RFC3986 isn't immeditely clear. But= on closer study,
>> I think it's simply saying that the characters are "safe" in t= he sense that
>> they are protected from change by URI normalization, hence tha= t when used as
>> delimiters there is no risk that the interpretation of the URI= is affected by
>> URI normalization (see also section 6 of RFC 3986).
>>
>> But some of these reserved characters already have defined pur= poses in URI
>> structure, and any scheme-dependent use needs to take care not= to interfere with
>> such use. For example, using "#" as a delimiter within a URI p= ath would
>> interfere with it's already-defined purpose to delimit a fragm= ent.
>>
>> Also, current URI structure *requires* that the ":" is used to= delimit the
>> scheme name from the rest of the URI. Suggestions by others on= this list to use
>> ":" rather than "#" are not entirely arbitrary.
>>
>> As a rule of thumb, I would suggest that if you do need scheme= -specific
>> delimiters (and it's not clear to me that you do), then using = one from the
>> "sub-delims" set is more likely to avoid conflicts with generi= c URI syntax and
>> interpretation.
>>
>> #g
>> --
>>
>>
>> On 28/05/2020 02:06, Timothy Mcsweeney wrote:
>>> Hi Dave,
>>>
>>> By "safe" I meant like ".....
>>>
>>> safe to be
>>> used by scheme-specific and producer-specific algorithms f= or
>>> delimiting data subcomponents within a URI"
>>>
>>> Like it says in section 2.2 of RFC3986.
>>>
>>> Tim
>>>
>>>> On May 27, 2020 at 8:48 PM Dave Thaler <=20 dthaler@microsoft.com
>>>> <mailto: dthaler@microsoft.com>&= gt; wrote:
>> >> s/URL/URI/ in both cases in my response J
>> >>
>> >> *From:*Uri-review <=20 uri-review-bounces@ietf.= org
>> <mailto: uri-review-bounces@ietf.= org>> *On Behalf Of *Dave Thaler
>> >> *Sent:* Wednesday, May 27, 2020 5:47 PM
>> >> *To:* Timothy Mcsweeney <=20 tim@dropnumber.com <mailto= : tim@dropnumber.com>>;
>> >> *Subject:* Re: [Uri-review] Request for review
>> >>
>> >>
>> >> I don=E2=80=99t understand your question.  = The URL syntax is fixed by that RFC.
>> >>
>> >> I don=E2=80=99t know what you mean by =E2=80=9Csafe= =E2=80=9D or =E2=80=9Cvalid=E2=80=9D.
>> >>
>> >> If by =E2=80=9Cvalid=E2=80=9D you mean =E2=80=9Callow= ed by RFC 3986=E2=80=9D, the answer is that they may only
>> >> appear in a URL literally
>> >>
>> >> if they have the exact meaning in the RFC, otherwise = they must be pct-encoded.
>> >>
>> >> *From:*Uri-review <=20 uri-review-bounces@ietf.= org
>> *On Behalf Of *Timothy Mcsweeney
>> >> *Sent:* Wednesday, May 27, 2020 5:05 PM
>> >> *To:*=20 uri-review@ietf.org <mail= to: uri-review@ietf.org> <= mailto:
>> >> *Subject:* Re: [Uri-review] Request for review
>> >>
>> >>
>> >> Hi Dave,
>> >>
>> >>
>> >> If the other six gen-delims from the reserved set wer= e safe and valid, would
>> >> you oppose their use in URIs?
>> >>
>> >>
>> >> Tim
>> >>
>> >>
>> >>
>> >>
>> >> On May 24, 2020 at 6:08 PM Dave Thaler <=20 dthaler@microsoft.com
>> <mailto: dthaler@microsoft.com>
>> >> <mailto:=20 dthaler@microsoft.com <= mailto: dthaler@microsoft.com>&= gt;> wrote:
>> >>
>> >> Hi Tim,
>> >>
>> >> Correct the colon is not part of the hier-part, the h= ier-part is what
>> >> comes after the colon.  RFC 3986 says:
>> >>
>> >> URI         = =3D scheme ":" hier-part [ "?" query ] [ "#" fragment ]
>> >>
>> >> Only strings that conform to the above are URIs.
>> >>
>> >> So =E2=80=9Cdrop#sd54g54=E2=80=9D is not a URI becaus= e it does not conform to the above
>> >> syntax, as it has no =E2=80=9C:=E2=80=9D
>> >>
>> >> =E2=80=9Cdrop:sd54g54=E2=80=9D on the other hand woul= d be a valid URI.
>> >>
>> >> This is what folks are saying when they say if you ju= st change the =E2=80=9C#=E2=80=9D to
>> >> a =E2=80=9C:=E2=80=9D in your draft then it becomes l= egal.
>> >>
>> >> Dave
>> >>
>> >> *From:*Uri-review <=20 uri-review-bounces@ietf.= org
>> *On Behalf Of *Timothy Mcsweeney
>> >> *Sent:* Sunday, May 24, 2020 11:26 AM
>> >> *To:* Erik Wilde <=20 erik.wilde@dret.net <mail= to: erik.wilde@dret.net>
>> <mailto:=20 erik.wilde@dret.net <mail= to: erik.wilde@dret.net>>&= gt;;
>> >>=20 uri-review@ietf.org <mail= to: uri-review@ietf.org> <= mailto:
>> >> *Subject:* Re: [Uri-review] Request for review
>> >>
>> >>
>> >> Hi Erik,
>> >>
>> >>
>> >> Thank you, I will have another look at my reference t= o section 3.
>> >>
>> >> Would you agree that in "=20 https:/= /ietf.org
>> >> < "" rel=3D"noopener"
>>
>> >> the colon is not part of the hier-part?
>> >>
>> <mailto: erik.wilde@dret.net>
>> >> <mailto:=20 erik.wilde@dret.net <mail= to: erik.wilde@dret.net>>&= gt; wrote:
>> >>
>> >>
>> >>
>> >> hey tim.
>> >>
>> >>
>> >> On 2020-05-24 17:53, Timothy Mcsweeney wrote:
>> >>
>> >> Yes, I agree and understand that the same way as you.=    But when
>> >> the "#"
>> >>
>> >> leaves the client it is not leaving as a fragment,
>> >>
>> >> what people are telling you is that "#" and anything = following it never
>> >>
>> >> leaves the client, by definition..
>> >>
>> >>
>> >> it is leaving as a
>> >>
>> >> way to separate the URI components, <scheme> an= d <path> or for http it
>> >>
>> >> would be separating <scheme> and <authority&= gt;.  It is this that
>> >> makes me
>> >>
>> >> believe that even if the colon is required for http r= esolution, it is
>> >>
>> >> not necessarily required for all URI.
>> >>
>> >> this discussion could be more productive if you had a= brief look at the
>> >>
>> >> specs you're depending on. the very first rule shown = in
>> >>
>> >> <
>>
>> >> is
>> >>
>> >>
>> >> URI =3D scheme ":" hier-part [ "?" query ] [ "#" frag= ment ]
>> >>
>> >>
>> >> each URI is defined like this and must have a colon.
>> >>
>> >>
>> >> cheers,
>> >>
>> >>
>> >> dret.
>> >>
>> >>
>> >> --
>> >>
>> >> erik wilde | mailto:=20 erik.wilde@dret.net <mail= to: erik.wilde@dret.net>
>> <mailto:=20 erik.wilde@dret.net <mail= to: erik.wilde@dret.net>> = |
>> >>
>> >> <
>>
>> >> |
>> >>
>> >> <
>>
>> >> |
>> >>
>> >>
>>>
>>> _______________________________________________
>>> Uri-review mailing list
=20 From nobody Sat May 30 07:02:41 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 43DB53A0477 for ; Sat, 30 May 2020 07:02:40 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.896 X-Spam-Level: X-Spam-Status: No, score=-1.896 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_MSPIKE_H3=0.001, RCVD_IN_MSPIKE_WL=0.001, SPF_HELO_NONE=0.001, SPF_PASS=-0.001, UNPARSEABLE_RELAY=0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id Mk8eF2_O7ZbI for ; Sat, 30 May 2020 07:02:38 -0700 (PDT) Received: from m9a0013g.houston.softwaregrp.com (m9a0013g.houston.softwaregrp.com [15.124.64.91]) (using TLSv1.2 with cipher DHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 31D263A03F6 for ; Sat, 30 May 2020 07:02:38 -0700 (PDT) Received: FROM m9a0013g.houston.softwaregrp.com (15.121.0.190) BY m9a0013g.houston.softwaregrp.com WITH ESMTP; Sat, 30 May 2020 14:01:46 +0000 Received: from M4W0335.microfocus.com (2002:f78:1193::f78:1193) by M9W0067.microfocus.com (2002:f79:be::f79:be) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256_P256) id 15.1.1591.10; Sat, 30 May 2020 14:02:00 +0000 Received: from NAM10-BN7-obe.outbound.protection.outlook.com (15.124.8.13) by M4W0335.microfocus.com (15.120.17.147) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256_P256) id 15.1.1591.10 via Frontend Transport; Sat, 30 May 2020 14:02:00 +0000 ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=QAnEFYjUGaWiY68m2tKpJllm1Dgd9CVqiajaDsGN7SSKa3sWuWNnT7wjSwFDN64bHKbYa7ZV7mm9mT1Cm3IhQWaQAr4zSAhtDGsY/QSVXs+9V/imYGOeS5SMdFsJbQoUCq1NlnwdzZ3GNkeKaVFu//cGzgt4zvGYYo7fdshSWXnRyJORAzkasHimtd8zvW5BO1RvWJ6iCnHIbfwq1jeEFOzHVkM822Mitta1oKNCtXkE+Ki+3COcus+5JxP47aPqux3VrtHPhedpsqdjVvhbMmBheK2vyRAmXDo9Xzss2P6cOvEiCG2T8YMX7NC4mUnULpquL0qWbVYSE4XAIOuK0Q== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=9PcGrTl4nasxyd5t3PFgCWWI+ok/v97OhdbeFm+Zgp4=; b=HfnTZ6aaoVvy/XVZfPaQWfcggjWfTcwZpHMlrW5MJO2nkApBoJQbUSlY6IYzxPYxIQcYRHlaQW0InP+U5Ff0lbUY7KvT9EMeO61i4hGF5KM2F5pox6Wu5G1ffooZ6Wt1aQMmkROKlbk/jao4g9JPaCeBOWaKcdUQXvKA53CMiHqNP4HbIZTLgCxpXHwFbi5qPxnYUG4AFHzQvTqEYaD76IBA99fK6dVDfxJsWh3/DjxxfvAYMScfVdi6RoaRS1RFCsYfpQW25sQCg7IYESqP0RMT1u7n06GXK1Hdh11k5CsTrqxOlaoIhh3bqzcSlqfC3YNywjHhFrmHUpgM89jVTw== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=pass smtp.mailfrom=microfocus.com; dmarc=pass action=none header.from=microfocus.com; dkim=pass header.d=microfocus.com; arc=none Received: from DM6PR18MB2700.namprd18.prod.outlook.com (2603:10b6:5:172::30) by DM6PR18MB3019.namprd18.prod.outlook.com (2603:10b6:5:189::26) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.3045.17; Sat, 30 May 2020 14:01:58 +0000 Received: from DM6PR18MB2700.namprd18.prod.outlook.com ([fe80::c9ee:a86c:56cd:3f16]) by DM6PR18MB2700.namprd18.prod.outlook.com ([fe80::c9ee:a86c:56cd:3f16%2]) with mapi id 15.20.3045.022; Sat, 30 May 2020 14:01:58 +0000 From: Michael Wojcik To: Timothy Mcsweeney , "uri-review@ietf.org" Thread-Topic: [Uri-review] Request for review Thread-Index: AQHWLXvVZweT8TYEzku3H6nMr+4sWaivKDl1gABmRgCAAPVoAIAA/yoAgABjTYCAAr7PAIABtHOAgADZ/gCAACfJAIAAEHSAgAACgYCAACgmgIAAPlAAgATXhYCAAAuxAIAAAFQAgAAFBQCAAif8AIAAcNOAgAEW/4CAADEygIAAGNWA Date: Sat, 30 May 2020 14:01:57 +0000 Message-ID: References: <491516506.246380.1589851279474@email.ionos.com> <5EC9B257.31362.CC5E003@dan.tobias.name> <1783049000.100771.1590323508943@email.ionos.com> <5ECA8A94.23977.101292FE@dan.tobias.name> <1426881880.158099.1590335585858@email.ionos.com> <94368b41-c15b-da2c-421d-fdd9300be6e9@dret.net> <1310141163.159340.1590344745080@email.ionos.com> <1081815563.141711.1590624311343@email.ionos.com> <117630321.142251.1590627970509@email.ionos.com> <8ae1641a-74c8-6c2d-7092-6cf53e745fb7@ninebynine.org> <797476254.282655.1590770737009@email.ionos.com> <656ab4ec-df34-c7a4-ed36-79a03623636c@ninebynine.org> <1435838702.391137.1590841215132@email.ionos.com> In-Reply-To: <1435838702.391137.1590841215132@email.ionos.com> Accept-Language: en-US Content-Language: en-US X-MS-Has-Attach: X-MS-TNEF-Correlator: authentication-results: dropnumber.com; dkim=none (message not signed) header.d=none;dropnumber.com; dmarc=none action=none header.from=microfocus.com; x-originating-ip: [216.158.249.99] x-ms-publictraffictype: Email x-ms-office365-filtering-correlation-id: 9d3017c4-f575-46ac-41c7-08d804a204cf x-ms-traffictypediagnostic: DM6PR18MB3019: x-microsoft-antispam-prvs: x-ms-oob-tlc-oobclassifiers: OLM:8273; x-forefront-prvs: 041963B986 x-ms-exchange-senderadcheck: 1 x-microsoft-antispam: BCL:0; x-microsoft-antispam-message-info: 5BJM6WI6GBMATOuO/eobCIKtN01atYEs5xfLiYYBQtIMpWhmSz1lqAGQrUrIAh+vIfZKXySbksENylcrz1tmf2ZsiEqBmTAI/Lwt6GZ1ZMiiMDsQfx0mWCBnPzo6lFSfF0rce5y8q1gUG2fP3DttIMM9eL3O/+GzQKRQZFo54wGuUmo9O+EQEomz7qoid+286Q34uKXJE7KNpXMuf3BqLKbMfV03vGQWsdLCeZDGUVjqmMBwP7EDx5/nQha6/fhhE52YepbCgAlVSVW3RB4q6RviG1Pk4Ol1W2/o5MHU1j/qlHs5+JPDz3yRfd0lQ+1BbvFHlzT5qVwNvNaFS13bww== x-forefront-antispam-report: CIP:255.255.255.255; CTRY:; LANG:en; SCL:1; SRV:; IPV:NLI; SFV:NSPM; H:DM6PR18MB2700.namprd18.prod.outlook.com; PTR:; CAT:NONE; SFTY:; SFS:(4636009)(396003)(366004)(376002)(346002)(39860400002)(136003)(6506007)(83380400001)(26005)(86362001)(478600001)(7696005)(33656002)(9686003)(55016002)(110136005)(53546011)(316002)(5660300002)(8676002)(66946007)(76116006)(66446008)(66476007)(52536014)(186003)(64756008)(66556008)(8936002)(71200400001)(2906002); DIR:OUT; SFP:1102; x-ms-exchange-antispam-messagedata: 2b++mOmPv5223gWuZmHZJX6RTOmxhFdojA94MWB/HT3ekajHqDYRng17dxqdBwPRG6g7InBTRhGfyDkn12SbOokXY2W9dpV6wGdpK6rXIhfQ9jj8AUtNc1W7lwS81tg2kbB8WgS6tem94fqDEn6YnndqYhuck9t5ulNzJH6ekQ0Sw3jFNhEieZ8RhcECZLt5zLc4M30Z2Fj9Kmk6nCj21uika106NmA9c59R+Rdhj7ZlYU+A1jCdiLQuihCq63h1bjhxPKpneTvT7TPZi5Oft9cJWk+unho22m9k5UJVeKH+ws7Ms15iUcj3CDZUSw0/CV6Z4zJ+g99JrTIzzTfihEidX3OG8fk9aLk1T+Ua9hOjrpEMXqrBpNO9hc2IENAMcLD4ycrfepV1BiYi6wb5HhVZfOEhi0ZrujGeiIKe9Mm2Or5AWFe0wWj6INEwE3f1tM0SUV9LBIGdhH33m8Ah6aI2K6g9PBFR+gV2Ct/Q48K85T7MY+No+yCFGk6+15wn x-ms-exchange-transport-forked: True Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: base64 MIME-Version: 1.0 X-MS-Exchange-CrossTenant-Network-Message-Id: 9d3017c4-f575-46ac-41c7-08d804a204cf X-MS-Exchange-CrossTenant-originalarrivaltime: 30 May 2020 14:01:58.2101 (UTC) X-MS-Exchange-CrossTenant-fromentityheader: Hosted X-MS-Exchange-CrossTenant-id: 856b813c-16e5-49a5-85ec-6f081e13b527 X-MS-Exchange-CrossTenant-mailboxtype: HOSTED X-MS-Exchange-CrossTenant-userprincipalname: HDtaAgORFxWfkDj9k3rGwv5gORZDoQd+iD280Was3LE4VbXAeRVCprtGBtFkRjzmihLCp+5Km4RF+G5h/4HuhVxe7RB0tYle0S8IJ+YSh7U= X-MS-Exchange-Transport-CrossTenantHeadersStamped: DM6PR18MB3019 X-OriginatorOrg: microfocus.com Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 30 May 2020 14:02:40 -0000 PiBGcm9tOiBVcmktcmV2aWV3IFttYWlsdG86dXJpLXJldmlldy1ib3VuY2VzQGlldGYub3JnXSBP biBCZWhhbGYgT2YgVGltb3RoeSBNY3N3ZWVuZXkNCj4gU2VudDogU2F0dXJkYXksIE1heSAzMCwg MjAyMCAwNjoyMA0KPiBUbzogR3JhaGFtIEtseW5lOyB1cmktcmV2aWV3QGlldGYub3JnDQoNCj4g QW5kIGlmIHBlb3BsZSB3YW50IHRvIG1ha2UgcGFyc2VycyB0aGF0IGRvbid0IHdvcmsgd2l0aCB0 aGUgc3BlYyBpdCBkb2Vzbid0DQo+IGJlY29tZSB0aGUgc3BlYydzIHByb2JsZW0uDQoNClRoYXQn cyBub3QgdGhlIGlzc3VlIGhlcmUuIFRoZSBpc3N1ZSBoZXJlIGlzIHRoYXQgeW91J3JlIG1pc2lu dGVycHJldGluZyBSRkMgMzk4Ni4NCg0KMzk4NiBzZWN0aW9uIDMgaXMgbm90IGFtYmlndW91cy4g VGhlIGZpcnN0IHByb2R1Y3Rpb24gaXM6DQoNClVSSSAgICAgICAgID0gc2NoZW1lICI6IiBoaWVy LXBhcnQgWyAiPyIgcXVlcnkgXSBbICIjIiBmcmFnbWVudCBdDQoNClRoZSBjb2xvbiBpcyBleHBs aWNpdCBhbmQgbm90IG9wdGlvbmFsLiBBIG1pbmltYWwgVVJJIGNvbnNpc3RzIG9mIGEgc2NoZW1l LCBhIGNvbG9uLCBhbmQgYSBoaWVyLXBhcnQuIFRoZXJlJ3Mgbm8gd2lnZ2xlIHJvb20gdGhlcmUs IGFuZCBubyBhbW91bnQgb2YgY2FzdWlzdHJ5IHJlZ2FyZGluZyBvdGhlciBwYXJ0cyBvZiAzOTg2 IHdpbGwgY2hhbmdlIHRoYXQuDQoNClNvbWVvbmUgY291bGQgYWxzbyBwb2ludCB0byAxLjIuMywg d2hlcmUgdGhlIGxhbmd1YWdlIGNsZWFybHkgbm90ZXMgdGhhdCB0aGUgY29sb24gaXMgdGhlIHNj aGVtZSBkZWxpbWl0ZXI7IG9yIDMuNSwgd2hpY2ggbWFrZXMgaXQgY2xlYXIgdGhhdCB0aGUgaGFz aCBzeW1ib2wgaXMgYWx3YXlzIHRoZSBmcmFnbWVudCBkZWxpbWl0ZXIuIEJ1dCB0aG9zZSBhcmd1 bWVudHMgYXJlIHJlZHVuZGFudCBpbiBsaWdodCBvZiB0aGUgZ2VuZXJpYy1VUkkgdG9wLWxldmVs IHByb2R1Y3Rpb24gdGhhdCBiZWdpbnMgc2VjdGlvbiAzLg0KDQpUbyBiZSBob25lc3QsIEkgZG9u J3QgdW5kZXJzdGFuZCB3aHkgeW91J3JlIGJlaW5nIHNvIGRpZmZpY3VsdCBhYm91dCB0aGlzLiBX aGF0J3MgeW91ciBtb3RpdmUgZm9yIHRyeWluZyB0byBmaW5kIGdyb3VuZHMgaW4gMzk4NiBmb3Ig cmVwdXJwb3NpbmcgdGhlIGZyYWdtZW50IGlkZW50aWZpZXI/DQoNCi0tDQpNaWNoYWVsIFdvamNp aw0K From nobody Sat May 30 08:00:48 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id E2D753A085C for ; Sat, 30 May 2020 08:00:46 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.795 X-Spam-Level: X-Spam-Status: No, score=-1.795 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, HTML_MESSAGE=0.001, MIME_HTML_ONLY=0.1, RCVD_IN_MSPIKE_H3=0.001, RCVD_IN_MSPIKE_WL=0.001, SPF_NONE=0.001, URIBL_BLOCKED=0.001] autolearn=no autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id BemBi9_KJYNn for ; Sat, 30 May 2020 08:00:45 -0700 (PDT) Received: from mout.perfora.net (mout.perfora.net [74.208.4.197]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 2ACEE3A09A2 for ; Sat, 30 May 2020 08:00:21 -0700 (PDT) Received: from oxusgaltgw03.schlund.de ([10.72.72.49]) by mrelay.perfora.net (mreueus004 [74.208.5.2]) with ESMTPSA (Nemesis) id 1Mw8kq-1ipPoz2pfQ-00s9iL; Sat, 30 May 2020 17:00:17 +0200 Date: Sat, 30 May 2020 11:00:16 -0400 (EDT) From: Timothy Mcsweeney Reply-To: Timothy Mcsweeney To: Michael Wojcik , uri-review@ietf.org Message-ID: <1759640974.393018.1590850816391@email.ionos.com> In-Reply-To: References: <491516506.246380.1589851279474@email.ionos.com> <5EC9B257.31362.CC5E003@dan.tobias.name> <1783049000.100771.1590323508943@email.ionos.com> <5ECA8A94.23977.101292FE@dan.tobias.name> <1426881880.158099.1590335585858@email.ionos.com> <94368b41-c15b-da2c-421d-fdd9300be6e9@dret.net> <1310141163.159340.1590344745080@email.ionos.com> <1081815563.141711.1590624311343@email.ionos.com> <117630321.142251.1590627970509@email.ionos.com> <8ae1641a-74c8-6c2d-7092-6cf53e745fb7@ninebynine.org> <797476254.282655.1590770737009@email.ionos.com> <656ab4ec-df34-c7a4-ed36-79a03623636c@ninebynine.org> <1435838702.391137.1590841215132@email.ionos.com> MIME-Version: 1.0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: 7bit X-Priority: 3 Importance: Normal X-Mailer: Open-Xchange Mailer v7.10.1-Rev31 X-Originating-Client: open-xchange-appsuite X-Provags-ID: V03:K1:liv1tisIwDPnpf6T69X1fkUJILCTdAyr44vVxZFttMurOyF7wCN 8ixq0tTDaC3Gy8LXdOTvisuZE4oAJ7ZZOc9VqCnWGkWl+8hz9rN5McyHDyoBKeMCGBjrwaF zBXTtO7LtJUbc+H6X9gCiGpndc5lP7g5HYa7D+V10Hm88cbEGO5wmUxZeNu1Eyvdu/0EIH7 ZtUddWAkRKastY+lDTe1Q== X-UI-Out-Filterresults: notjunk:1;V03:K0:70DAmasOALQ=:D/VsqhO4pbi4C1p9jXjV5P ot6FWYxGfDOGel1k5djRJCbgKreP380yG13EIfoP/Nm+YZ9ZMIp950Sh5gnUTK9SM2XXhoFj8 MFlTI/40EMz6lGpPa718V4dtBKyCL//CokQPgpmhjdIF3/4BeVbS54gEEAht1euvcL2G98Akc h/1HQSf7KIHgPNuaNeSNGq48zkowAnAq6yr6jOazsCAug3ONcac8I0Y/pr4xv/FSFjzWSFQLl 7SP9RpTghls4qT1Pr0ngbSqLrMU8IDceJ2yhUb80+bsZ+h4y4UZg2m6dDZML1l9/jkJz6Aiaq GJz51wyhxuM32enFxW/lj69wy03ZyoBYtkiSczdNNj4FapvRbdzcK9NnPkqyHbsy3E0i1lW63 bdpJ6LK1GOfdMPz3fsuXjeyyJSdRJ6Qs1PrWPEg30Hhb9NdRgZRwf9951QxC24GF2oDibYBX/ t2KwiR2MQexWZgIuEmCnMcJneyHNHVK6SMc6rtno0bVglBB6apT2UO5MBc3pvUMcBPCU5V0+A D0lvhfQFSlXuAx1OO9hOwjInKshL2pUCQSF1bTs5KJeGHX7y5QubNT7j45AILZ9BIKu5mJEiH A7X1DFQTwX5FCQwnzpQqxuVUJlmgvsVuwytBxaTEI4rAhJB1grp+m+1Oa4HXKABjsRGi18SLC 5jdI48VraF2cRDIzqA8unjJpeYRZV9IX3SyaOhvMv/ZCtxJ2qKVM7hrXqUtq/t4BG5t7HyZTz 3Rn69BRbh8PhSzWih3NbsDdjWVtZuViKK2VfWFHku6Q2vizheZMMziQSunKdCytzaFJ4iSE7K hytz4EH1ZxYrYKq/MmO/matoZfvurzqo4zf3ZHjrjT194SeZwam+T6TwF/CMjtwr/e7Z3LK Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 30 May 2020 15:00:47 -0000
On May 30, 2020 at 10:01 AM Michael Wojcik < Michael.Wojcik@microfocus.com> wrote:


From: Uri-review [mailto: uri-review-bounces@ietf.org] On Behalf Of Timothy Mcsweeney
Sent: Saturday, May 30, 2020 06:20
To: Graham Klyne; uri-review@ietf.org
And if people want to make parsers that don't work with the spec it doesn't
become the spec's problem.
That's not the issue here. The issue here is that you're misinterpreting RFC 3986.

3986 section 3 is not ambiguous. The first production is:

URI = scheme ":" hier-part [ "?" query ] [ "#" fragment ]

The colon is explicit and not optional. A minimal URI consists of a scheme, a colon, and a hier-part. There's no wiggle room there, and no amount of casuistry regarding other parts of 3986 will change that.

Someone could also point to 1.2.3, where the language clearly notes that the colon is the scheme delimiter; or 3.5, which makes it clear that the hash symbol is always the fragment delimiter. But those arguments are redundant in light of the generic-URI top-level production that begins section 3.

To be honest, I don't understand why you're being so difficult about this. What's your motive for trying to find grounds in 3986 for repurposing the fragment identifier?

--
Michael Wojcik
From nobody Sat May 30 08:27:08 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id C3CE13A08D3 for ; Sat, 30 May 2020 08:27:06 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.795 X-Spam-Level: X-Spam-Status: No, score=-1.795 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, HTML_MESSAGE=0.001, MIME_HTML_ONLY=0.1, RCVD_IN_MSPIKE_H3=0.001, RCVD_IN_MSPIKE_WL=0.001, SPF_NONE=0.001, URIBL_BLOCKED=0.001] autolearn=no autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id KB17eaV9yvTu for ; Sat, 30 May 2020 08:27:05 -0700 (PDT) Received: from mout.perfora.net (mout.perfora.net [74.208.4.194]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 5C06C3A08D4 for ; Sat, 30 May 2020 08:27:05 -0700 (PDT) Received: from oxusgaltgw03.schlund.de ([10.72.72.49]) by mrelay.perfora.net (mreueus003 [74.208.5.2]) with ESMTPSA (Nemesis) id 0Lm2Pn-1j6GfR2Lsf-00ZiOz for ; Sat, 30 May 2020 17:27:04 +0200 Date: Sat, 30 May 2020 11:27:04 -0400 (EDT) From: Timothy Mcsweeney Reply-To: Timothy Mcsweeney To: uri-review@ietf.org Message-ID: <906613693.393411.1590852424418@email.ionos.com> In-Reply-To: References: <491516506.246380.1589851279474@email.ionos.com> <5EC9B257.31362.CC5E003@dan.tobias.name> <1783049000.100771.1590323508943@email.ionos.com> <5ECA8A94.23977.101292FE@dan.tobias.name> <1426881880.158099.1590335585858@email.ionos.com> <94368b41-c15b-da2c-421d-fdd9300be6e9@dret.net> <1310141163.159340.1590344745080@email.ionos.com> <1081815563.141711.1590624311343@email.ionos.com> <117630321.142251.1590627970509@email.ionos.com> <8ae1641a-74c8-6c2d-7092-6cf53e745fb7@ninebynine.org> <797476254.282655.1590770737009@email.ionos.com> <656ab4ec-df34-c7a4-ed36-79a03623636c@ninebynine.org> <1435838702.391137.1590841215132@email.ionos.com> MIME-Version: 1.0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: 7bit X-Priority: 3 Importance: Normal X-Mailer: Open-Xchange Mailer v7.10.1-Rev31 X-Originating-Client: open-xchange-appsuite X-Provags-ID: V03:K1:hZAg/UU2mVgjErz2tcLC7q4MHxjJZZelRv0A6sGeXKGLu/YiXd7 uIQmX3t/dgIB7Zzrey2Z2NmzXz14X193cEzRXCOG1Mz8VHHOqbmLctVwJNo+ASp9i20eUG5 o8PKRAKqS3ptJnMg6CNClUcnDnLdlVzRos42EaD3KbA9D/UzuFpjFBTsPQkOoD8Q5PXqBrn zvFfMizMjy6fk9YuWSMJA== X-UI-Out-Filterresults: notjunk:1;V03:K0:0BxIQTqTnhc=:ethuUnbRQJUjjfvXALLpDs QR6+f9kwI6d0/DDxAtz2FD5y6w3ynzlgddT8VPBnVq0iInFg9O8/frT/2+KkfqySVFRF0lm84 K6JEZUCMy4/Zv/E6keTweoBkxQBG3nWKmXnVyGwZBo8jNorfZE6YDbgnDnlzV1B4KaKv2elmO YyMRFqjnOgzpvFOFHPGEITXvzi/8ghj2Tfh0bG3BdwMEYmZgCwKO5XBFhDmMfKtCY8FRZCY88 EjVVlBqDfmzq7kunKygKxKWgtEKq5tgyHv67umI4JWdw9Oqf4w0RPKZy9YXpCMeqtYAzd8IAn 1luKzUhyZ7oDahmX/2VgCgQEa0d2b6Guy7KI8jrY1fKeGW0v0FeNg5Jtr9qC1zVmvJHxpYDdC 28zp2ma+wbesgoPeeteOU5+WCXMKPo8yCIUuG1XjoHwLPyFhU5t+XMtF52dwIFG/uMsalhuNc 98BXMGWnSo3Q7qcvZGJcNJHCJaNU8wzFDrKx9/RLwucfOO0Z/9SUeUyQT3YytGFBJe4hdn2HO oyr63BQpZs/NWYoFDGxIl8iTG5gCfKoLlhXBgJXUPfprT4hxprXERNLbk7urEx6+vQYcTcIUI Oq/xda14xzuyXZiDmnc79mGGUyspDGKHoAvMcWg5FW0KsyEs0CuVeh+txZoN8OvWv37Fy+/so alFvwlrZleQYaoD2RyJ9Lc7LyTigUPoS3TijgPQXzr/mCDbQBqSgsxzhqfoVB+uI1hHIOAGED byKhw8BJn7LxIBAcQ13EMoU1u0qu22asnXkXOCrQnA0S2xjHttx4qte6udqltcvVDW/1eghbp D5xmoa3Tfc6LQ8j1Ir0uxx7U3mfrpdNcq37VYQGoVTTxIIn7jIdFapPHuHVaGA9jpFZcyYk Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 30 May 2020 15:27:07 -0000

Hi Michael,

Before I reply to that, I want to be sure you and I are on the same page about
how my draft works. Using the browser example, drop#mk34s is queried,
reponses given, the browser then goes to <http://mk34s.dropexample.com>
 and in the browser address bar it says <http://mk34s.dropexample.com>.

Is that how you understand my draft?

Tim

On May 30, 2020 at 10:01 AM Michael Wojcik < Michael.Wojcik@microfocus.com> wrote:


From: Uri-review [mailto: uri-review-bounces@ietf.org] On Behalf Of Timothy Mcsweeney
Sent: Saturday, May 30, 2020 06:20
To: Graham Klyne; uri-review@ietf.org
And if people want to make parsers that don't work with the spec it doesn't
become the spec's problem.
That's not the issue here. The issue here is that you're misinterpreting RFC 3986.

3986 section 3 is not ambiguous. The first production is:

URI = scheme ":" hier-part [ "?" query ] [ "#" fragment ]

The colon is explicit and not optional. A minimal URI consists of a scheme, a colon, and a hier-part. There's no wiggle room there, and no amount of casuistry regarding other parts of 3986 will change that.

Someone could also point to 1.2.3, where the language clearly notes that the colon is the scheme delimiter; or 3.5, which makes it clear that the hash symbol is always the fragment delimiter. But those arguments are redundant in light of the generic-URI top-level production that begins section 3.

To be honest, I don't understand why you're being so difficult about this. What's your motive for trying to find grounds in 3986 for repurposing the fragment identifier?

--
Michael Wojcik
From nobody Sun May 31 07:03:08 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 0F08A3A0849 for ; Sun, 31 May 2020 07:03:07 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.896 X-Spam-Level: X-Spam-Status: No, score=-1.896 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_MSPIKE_H3=0.001, RCVD_IN_MSPIKE_WL=0.001, SPF_HELO_NONE=0.001, SPF_PASS=-0.001, UNPARSEABLE_RELAY=0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id KDvGJFLZIQM4 for ; Sun, 31 May 2020 07:03:05 -0700 (PDT) Received: from m9a0014g.houston.softwaregrp.com (m9a0014g.houston.softwaregrp.com [15.124.64.90]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 0D6D03A083F for ; Sun, 31 May 2020 07:03:04 -0700 (PDT) Received: FROM m9a0014g.houston.softwaregrp.com (15.121.0.190) BY m9a0014g.houston.softwaregrp.com WITH ESMTP FOR uri-review@ietf.org; Sun, 31 May 2020 14:02:15 +0000 Received: from M4W0334.microfocus.com (2002:f78:1192::f78:1192) by M9W0067.microfocus.com (2002:f79:be::f79:be) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256_P256) id 15.1.1591.10; Sun, 31 May 2020 14:02:52 +0000 Received: from NAM11-DM6-obe.outbound.protection.outlook.com (15.124.8.11) by M4W0334.microfocus.com (15.120.17.146) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256_P256) id 15.1.1591.10 via Frontend Transport; Sun, 31 May 2020 14:02:53 +0000 ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=EOm8/jMT8j3FO1Y/avTEB5d0S3eWDDlwMVHH8KkXOSz5TM3nq3Cc54WK3Fv90acSdiXdCPH+iXxcfQVoDtobB0j0IlMbrCWeCL52J/O6F7LxChvw9PWUA9TrHmVnDkB7+56W67eUEyZZLUZvd8BVzUVvrHUlgmprMTLZZHAVHkbO6iae3gbvNpwmU7ImMA4V4FvynLRZ9k+1Z8trvvPQgSTrTP1+aeC3itXbL0IjeoV8QUCSuUe1lx6M+fs6OXYdblACn+ZA06iGeeIq7pCgdFBm1CQEgmDzCtEcgKb0/rFGgJrFoYXqYCKMX3mzkmB6O2KolEF+aWoP9gBDAJGo2g== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=kdb5rAuuFYnySRNGq29SoH6v/zv6sGDLIih51PpX8rw=; b=ZQklj3opY39nB/AhD3VGkLIkf8WHpCjuuwldDUXPpcIIowDv4oECuRDQz9AjaKWGYQMlWIPhw9aMuctUgIBksil9LcsuRuESAvEsGHulyFS5+3p+PXitPh6W9/cJXGg/49MaiknxoGH7WLlmPScsex4yp20DlWnx1xjOqs3TA91HulRlVIl5d+fSrnI0QOb+bPWGpZGeIV09dGsGLa11W7vDTNvPWVQxooYHBgDilI12L6JRsm13SXCl6fLDzbUAM/fK+mIOM+BubCBO00Zns4Q92bixps7sYBIz8ZR+eUN4fmgDQpUwxpMfFy3/DuN5cRrgskiTDh9MpggcTygsrA== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=pass smtp.mailfrom=microfocus.com; dmarc=pass action=none header.from=microfocus.com; dkim=pass header.d=microfocus.com; arc=none Received: from DM6PR18MB2700.namprd18.prod.outlook.com (2603:10b6:5:172::30) by DM6PR18MB3242.namprd18.prod.outlook.com (2603:10b6:5:1cf::30) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.3045.21; Sun, 31 May 2020 14:02:50 +0000 Received: from DM6PR18MB2700.namprd18.prod.outlook.com ([fe80::c9ee:a86c:56cd:3f16]) by DM6PR18MB2700.namprd18.prod.outlook.com ([fe80::c9ee:a86c:56cd:3f16%2]) with mapi id 15.20.3045.022; Sun, 31 May 2020 14:02:50 +0000 From: Michael Wojcik To: "uri-review@ietf.org" Thread-Topic: [Uri-review] Request for review Thread-Index: AQHWLXvVZweT8TYEzku3H6nMr+4sWaivKDl1gABmRgCAAPVoAIAA/yoAgABjTYCAAr7PAIABtHOAgADZ/gCAACfJAIAAEHSAgAACgYCAACgmgIAAPlAAgATXhYCAAAuxAIAAAFQAgAAFBQCAAif8AIAAcNOAgAEW/4CAADEygIAANEnWgAF2yuA= Date: Sun, 31 May 2020 14:02:50 +0000 Message-ID: References: <491516506.246380.1589851279474@email.ionos.com> <5EC9B257.31362.CC5E003@dan.tobias.name> <1783049000.100771.1590323508943@email.ionos.com> <5ECA8A94.23977.101292FE@dan.tobias.name> <1426881880.158099.1590335585858@email.ionos.com> <94368b41-c15b-da2c-421d-fdd9300be6e9@dret.net> <1310141163.159340.1590344745080@email.ionos.com> <1081815563.141711.1590624311343@email.ionos.com> <117630321.142251.1590627970509@email.ionos.com> <8ae1641a-74c8-6c2d-7092-6cf53e745fb7@ninebynine.org> <797476254.282655.1590770737009@email.ionos.com> <656ab4ec-df34-c7a4-ed36-79a03623636c@ninebynine.org> <1435838702.391137.1590841215132@email.ionos.com> <906613693.393411.1590852424418@email.ionos.com> In-Reply-To: <906613693.393411.1590852424418@email.ionos.com> Accept-Language: en-US Content-Language: en-US X-MS-Has-Attach: X-MS-TNEF-Correlator: authentication-results: ietf.org; dkim=none (message not signed) header.d=none;ietf.org; dmarc=none action=none header.from=microfocus.com; x-originating-ip: [216.158.249.99] x-ms-publictraffictype: Email x-ms-office365-filtering-correlation-id: 749f878f-f204-471e-c668-08d8056b4e6e x-ms-traffictypediagnostic: DM6PR18MB3242: x-microsoft-antispam-prvs: x-ms-oob-tlc-oobclassifiers: OLM:8273; x-forefront-prvs: 0420213CCD x-ms-exchange-senderadcheck: 1 x-microsoft-antispam: BCL:0; x-microsoft-antispam-message-info: Y1K4vqUJsmAKs0mCwIzrcGu5V/W0nupVujqgWMIxICI54Pw6xdmzBah8wW4oxScwHynZIRdpou/Q5g80Bz+TFEfd7q/ttcwUyEC2XI2ie8bipq0XCmjs1kaXHbVk2c4tCFwmtisvb6uT/ozVEAiKD/rtVp7mgmt8EThNyzLXBvHlXMi3k6sYnz753t3MiaGIpiLSvkZpB/KwmXC1OwMt5AiV55Tn++a8xMqCNGNYH3voKF3UdCUGzr9nVOGyZkv0Z75B2dK4BlkBSarTSU5AafD6JlRgnx8PFP17Qb7wzHEXMIU3Z0644uj/yAizMAIDGKzChCvtQ1/Ib/zag3ImqjtSHkTJdmxFX1mxJJiNZlU= x-forefront-antispam-report: CIP:255.255.255.255; CTRY:; LANG:en; SCL:1; SRV:; IPV:NLI; SFV:NSPM; H:DM6PR18MB2700.namprd18.prod.outlook.com; PTR:; CAT:NONE; SFTY:; SFS:(4636009)(396003)(136003)(346002)(366004)(39860400002)(376002)(8936002)(66946007)(186003)(76116006)(53546011)(6506007)(86362001)(316002)(71200400001)(26005)(66446008)(64756008)(2906002)(66556008)(66476007)(66574014)(33656002)(4744005)(7696005)(478600001)(55016002)(9686003)(8676002)(52536014)(6916009)(5660300002); DIR:OUT; SFP:1102; x-ms-exchange-antispam-messagedata: XhvixLvcmDfc52oYUxjLhQKAflRJZ4WqKDEnUYJsIyPQ5CAwfkPIPiozdYMV9qfFHnBXFmGgc7YxZ3R9Go9eNcOGUER6JZvCZh15dcdQmTsMAnF83CS6k+7LGvWpOyKIqdM7VxfgHBijru7v3gSS1FYJvMnFx1OJ+mUgdveGSG6dCCOWQZqxjQBOAmiIP59YiReLUzKX5cwHz7VVCoTwn/Zs2bTHcvlLBuVMZ9Uozrn0V2GF0knFuE+jvmE1SlnfhQqHTwbhcQT44kr3AWDOWGbZ07Nqq9fjFIYKPnq1hr2i5jXZ2w3zX1ECvMcOADsJ/U2AkvJTUOX/j4r1PT7gYw21ojzpfZITvpBeRxYACqbf56zSbOGRDzbefrdu4eyTGZXGvo0kqYRXUlp+kXaotJvyJ7RTgs0rQuIiTdlbE1b+agMaJedf/NBBfpKMIY28u9lU9fKtPo6TRR5jt6ZecVz7luQZt5Plaqq9DCvfaSeO8W3ZKEtTK+pjLn+xyx47 x-ms-exchange-transport-forked: True Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: base64 MIME-Version: 1.0 X-MS-Exchange-CrossTenant-Network-Message-Id: 749f878f-f204-471e-c668-08d8056b4e6e X-MS-Exchange-CrossTenant-originalarrivaltime: 31 May 2020 14:02:50.7038 (UTC) X-MS-Exchange-CrossTenant-fromentityheader: Hosted X-MS-Exchange-CrossTenant-id: 856b813c-16e5-49a5-85ec-6f081e13b527 X-MS-Exchange-CrossTenant-mailboxtype: HOSTED X-MS-Exchange-CrossTenant-userprincipalname: VyqKNcxI204iCYAjLkzKGm2HylM/4cPpKO9ZRuofLls1I3+JRgDu/l+BUne4iMc+8xIfCYxtN8xjenOqLcmVNzZPXn5GACKK9HVkIJJebv0= X-MS-Exchange-Transport-CrossTenantHeadersStamped: DM6PR18MB3242 X-OriginatorOrg: microfocus.com Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 31 May 2020 14:03:07 -0000 PiBGcm9tOiBVcmktcmV2aWV3IFttYWlsdG86dXJpLXJldmlldy1ib3VuY2VzQGlldGYub3JnXSBP biBCZWhhbGYgT2YgVGltb3RoeSBNY3N3ZWVuZXkNCj4gU2VudDogU2F0dXJkYXksIE1heSAzMCwg MjAyMCAwOToyNw0KPiBUbzogdXJpLXJldmlld0BpZXRmLm9yZw0KDQo+IEJlZm9yZSBJIHJlcGx5 IHRvIHRoYXQsIEkgd2FudCB0byBiZSBzdXJlIHlvdSBhbmQgSSBhcmUgb24gdGhlIHNhbWUgcGFn ZSBhYm91dA0KPiBob3cgbXkgZHJhZnQgd29ya3MuIFVzaW5nIHRoZSBicm93c2VyIGV4YW1wbGUs IGRyb3AjbWszNHMgaXMgcXVlcmllZCwNCj4gcmVwb25zZXMgZ2l2ZW4sIHRoZSBicm93c2VyIHRo ZW4gZ29lcyB0byA8aHR0cDovL21rMzRzLmRyb3BleGFtcGxlLmNvbT4NCj4gYW5kIGluIHRoZSBi cm93c2VyIGFkZHJlc3MgYmFyIGl0IHNheXMgPGh0dHA6Ly9tazM0cy5kcm9wZXhhbXBsZS5jb20+ Lg0KDQo+IElzIHRoYXQgaG93IHlvdSB1bmRlcnN0YW5kIG15IGRyYWZ0Pw0KDQpGcmFua2x5LCBJ IGRvbid0IHNlZSBob3cgdGhhdCdzIHJlbGV2YW50IHRvIG15IHBvaW50LiBCdXQgZm9yIHRoZSBz YWtlIG9mIGFyZ3VtZW50IChldmVuIGlmIEknbSBub3QgYXQgYWxsIGNvbnZpbmNlZCBpdCdzIGFu IGFyZ3VtZW50IHdvcnRoIGhhdmluZyksIHN1cmUsIGxldCdzIHNheSB0aGF0J3MgaG93IEkgdW5k ZXJzdGFuZCBpdC4NCg0KLS0NCk1pY2hhZWwgV29qY2lrDQpEaXN0aW5ndWlzaGVkIEVuZ2luZWVy LCBNaWNybyBGb2N1cw0KDQoNCg0KDQo= From nobody Sun May 31 11:24:49 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id A433C3A0B08 for ; Sun, 31 May 2020 11:24:48 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.898 X-Spam-Level: X-Spam-Status: No, score=-1.898 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_MSPIKE_H2=-0.001, SPF_HELO_NONE=0.001, SPF_NONE=0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id Vfc1Gf0dV0tt for ; Sun, 31 May 2020 11:24:47 -0700 (PDT) Received: from dragonfly.birch.relay.mailchannels.net (dragonfly.birch.relay.mailchannels.net [23.83.209.51]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 79C953A0A50 for ; Sun, 31 May 2020 11:24:47 -0700 (PDT) X-Sender-Id: dreamhost|x-authsender|mail@dan.tobias.name Received: from relay.mailchannels.net (localhost [127.0.0.1]) by relay.mailchannels.net (Postfix) with ESMTP id 84A52320D8D for ; Sun, 31 May 2020 18:24:46 +0000 (UTC) Received: from pdx1-sub0-mail-a58.g.dreamhost.com (100-96-6-17.trex.outbound.svc.cluster.local [100.96.6.17]) (Authenticated sender: dreamhost) by relay.mailchannels.net (Postfix) with ESMTPA id 28AF7320C32 for ; Sun, 31 May 2020 18:24:46 +0000 (UTC) X-Sender-Id: dreamhost|x-authsender|mail@dan.tobias.name Received: from pdx1-sub0-mail-a58.g.dreamhost.com (pop.dreamhost.com [64.90.62.162]) (using TLSv1.2 with cipher DHE-RSA-AES256-GCM-SHA384) by 0.0.0.0:2500 (trex/5.18.8); Sun, 31 May 2020 18:24:46 +0000 X-MC-Relay: Neutral X-MailChannels-SenderId: dreamhost|x-authsender|mail@dan.tobias.name X-MailChannels-Auth-Id: dreamhost X-Grain-Bitter: 1e50420847df45e1_1590949486374_1767595664 X-MC-Loop-Signature: 1590949486374:470774744 X-MC-Ingress-Time: 1590949486373 Received: from pdx1-sub0-mail-a58.g.dreamhost.com (localhost [127.0.0.1]) by pdx1-sub0-mail-a58.g.dreamhost.com (Postfix) with ESMTP id D873A80458 for ; Sun, 31 May 2020 11:24:45 -0700 (PDT) Received: from [10.0.0.2] (c-73-245-214-115.hsd1.fl.comcast.net [73.245.214.115]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) (Authenticated sender: mail@dan.tobias.name) by pdx1-sub0-mail-a58.g.dreamhost.com (Postfix) with ESMTPSA id 08E8C8047B for ; Sun, 31 May 2020 11:24:43 -0700 (PDT) X-DH-BACKEND: pdx1-sub0-mail-a58 From: "Daniel R. Tobias" To: uri-review@ietf.org Date: Sun, 31 May 2020 14:24:43 -0400 MIME-Version: 1.0 Message-ID: <5ED3F66B.7204.10663FF@dan.tobias.name> Priority: normal In-reply-to: References: <491516506.246380.1589851279474@email.ionos.com>, <1435838702.391137.1590841215132@email.ionos.com>, X-mailer: Pegasus Mail for Windows (4.73.639) Content-type: text/plain; charset=US-ASCII Content-transfer-encoding: 7BIT Content-description: Mail message body X-VR-OUT-STATUS: OK X-VR-OUT-SCORE: 0 X-VR-OUT-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeduhedrudeffedguddvudcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucggtfgfnhhsuhgsshgtrhhisggvpdfftffgtefojffquffvnecuuegrihhlohhuthemuceftddtnecunecujfgurhephffvffgguffkjghfofgtgfesthfuredtffdtvdenucfhrhhomhepfdffrghnihgvlhcutfdrucfvohgsihgrshdfuceouggrnhesthhosghirghsrdhnrghmvgeqnecuggftrfgrthhtvghrnhepteekhffhueevtefftdeugeehtdevjeffhfegheeutdeiveevfeduleelvdehgfejnecuffhomhgrihhnpegurghnrdhinhhfohenucfkphepjeefrddvgeehrddvudegrdduudehnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmohguvgepshhmthhppdhhvghloheplgdutddrtddrtddrvdgnpdhinhgvthepjeefrddvgeehrddvudegrdduudehpdhrvghtuhhrnhdqphgrthhhpedfffgrnhhivghlucftrdcuvfhosghirghsfdcuoegurghnsehtohgsihgrshdrnhgrmhgvqedpmhgrihhlfhhrohhmpegurghnsehtohgsihgrshdrnhgrmhgvpdhnrhgtphhtthhopehurhhiqdhrvghvihgvfiesihgvthhfrdhorhhg Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 31 May 2020 18:24:49 -0000 On 30 May 2020 at 14:01, Michael Wojcik wrote: > To be honest, I don't understand why you're being so difficult about > this. What's your motive for trying to find grounds in 3986 for > repurposing the fragment identifier? I'm struggling to figure out what the guy's true agenda is, too; why he's so wedded to the nonstandard syntax he is proposing. Maybe he's got an implementation out there somewhere with the quirky syntax embedded that he doesn't want to have to change? -- == Dan == Dan's Mail Format Site: http://mailformat.dan.info/ Dan's Web Tips: http://webtips.dan.info/ Dan's Domain Site: http://domains.dan.info/ From nobody Sun May 31 12:02:54 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 9BBD83A0BDD for ; Sun, 31 May 2020 12:02:53 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.795 X-Spam-Level: X-Spam-Status: No, score=-1.795 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, HTML_MESSAGE=0.001, MIME_HTML_ONLY=0.1, RCVD_IN_MSPIKE_H3=0.001, RCVD_IN_MSPIKE_WL=0.001, SPF_NONE=0.001, URIBL_BLOCKED=0.001] autolearn=no autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id Zjm9oxgqiEuV for ; Sun, 31 May 2020 12:02:52 -0700 (PDT) Received: from mout.perfora.net (mout.perfora.net [74.208.4.194]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 205873A0E53 for ; Sun, 31 May 2020 12:02:17 -0700 (PDT) Received: from oxusgaltgw03.schlund.de ([10.72.72.49]) by mrelay.perfora.net (mreueus002 [74.208.5.2]) with ESMTPSA (Nemesis) id 0LfU6x-1jCOn030eX-00p12x; Sun, 31 May 2020 21:02:15 +0200 Date: Sun, 31 May 2020 15:02:15 -0400 (EDT) From: Timothy Mcsweeney Reply-To: Timothy Mcsweeney To: "Daniel R. Tobias" , uri-review@ietf.org Message-ID: <635829576.405068.1590951735546@email.ionos.com> In-Reply-To: <5ED3F66B.7204.10663FF@dan.tobias.name> References: <491516506.246380.1589851279474@email.ionos.com>, <1435838702.391137.1590841215132@email.ionos.com>, <5ED3F66B.7204.10663FF@dan.tobias.name> MIME-Version: 1.0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: 7bit X-Priority: 3 Importance: Normal X-Mailer: Open-Xchange Mailer v7.10.1-Rev31 X-Originating-Client: open-xchange-appsuite X-Provags-ID: V03:K1:f24uWMXj6ouSN/SlL4TUXnMuclzFNqYrp0Pqz9f7uYF8uivJsdO rZiqdbw/cH+4IP6bL2fuBNEr26pQAN0V7OAb7WajNMOUD45tuwpOBetqzVydpB+kShbVY/i JgOmwOpU0B9MjZ/3rk5bAjaz7ONvOQK2QwgUcAPHukuEYByM67I2xd7gqjwYvJGQopoHwtP l04ax/B/VYYLAu7YAfSAQ== X-UI-Out-Filterresults: notjunk:1;V03:K0:qwk07gQ+/Is=:HsB3/0e/R+AGO6kPAOmhda jiRMms9zBosuFqcjPnVWlhDhMSgQhSHTLJT3BadQCL1o7hYk1sdpvHRg2G9laNqyb+vdGMf9o pak2q7avD+bl8Z8Mf15BBiMQ5JX1lIkVT7gLJUV49MriIe2lnN6lZc8AHRAQnaQzk/MzmofyQ qcoFdQ+FkiYLswUTjmriTIcr+ZOOnO+XU99y0N5sxizlTh/EMgpuvU2Wktv1KeE6HBYbijcFq Za7Ru0EajQ7j1jTDJjt1VHqJdjfY/pj8HJlW+VaNzmwaX2/qsZbkyTiIZripKG6R6P3KPj6g8 Ro2lIwnTUTsETT8EFL7a0a0gCuxwU5s9BXR94Pl3VqD7TIizfubhGq7UPujzZHWQ6ttUfAzR3 1v2n1kowl+JVJFkcq5WtWslAyOREsUP77DnPpXa2NggWVwtqtURlMiJi/WKshzA/1MBYvd9nE BMdJOthI75TtD0bvr5TpSwm7IgroAY5oSAwAUvr/Wg4RUh/qRjnnZ/52G8SOHNivDkSP7MqB0 z9YhVI3wQNROmg088uwe/dlxNzDss3qnhZlyjvU21KGbVJNppnhHkdE/o9hrK12jrJc4rEo38 Bz7gs0BokfPjaSao4ZuG8LUHRRJVwYAd//w4yN+B2ot9Q1oOHfcR0ZziTJTe5gB6iBm4RT+ow g7PZeKurgFlzZ4VotVLrKYSOUKX9r5NnGCoaPe/zG111Y0zDnv7nNdkiJnaJQipWaqCbzSUOk CReOthyvWGEAJkAem9gkYiDXF83P+0BLHRzYB0mv8f2o7WL2mQQIyp6JL8c40nOrZ3Qf/PtPY QDAG48lK/t2YRoN7P9+AbdmbPQyhI0YWbfbk97wmYI2M+ffoHqqDIAuY+WStIg5UcKdHVzr Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 31 May 2020 19:02:54 -0000
I am bringing a product to market.  In the draft it says dropexample.com and my email, as you know, my is dropnumber.com.  So its drop number, not drop colon.  Your struggle is over.


On May 31, 2020 at 2:24 PM "Daniel R. Tobias" < dan@tobias.name> wrote:


On 30 May 2020 at 14:01, Michael Wojcik wrote:

To be honest, I don't understand why you're being so difficult about
this. What's your motive for trying to find grounds in 3986 for
repurposing the fragment identifier?
I'm struggling to figure out what the guy's true agenda is, too; why
he's so wedded to the nonstandard syntax he is proposing. Maybe he's
got an implementation out there somewhere with the quirky syntax
embedded that he doesn't want to have to change?

--
== Dan ==
Dan's Mail Format Site: http://mailformat.dan.info/
Dan's Web Tips: http://webtips.dan.info/
Dan's Domain Site: http://domains.dan.info/


_______________________________________________
Uri-review mailing list
From nobody Sun May 31 12:16:07 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id A55F03A0C29 for ; Sun, 31 May 2020 12:16:05 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.795 X-Spam-Level: X-Spam-Status: No, score=-1.795 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, HTML_MESSAGE=0.001, MIME_HTML_ONLY=0.1, RCVD_IN_MSPIKE_H3=0.001, RCVD_IN_MSPIKE_WL=0.001, SPF_NONE=0.001, URIBL_BLOCKED=0.001] autolearn=no autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id b9nmTZOog57W for ; Sun, 31 May 2020 12:16:01 -0700 (PDT) Received: from mout.perfora.net (mout.perfora.net [74.208.4.197]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 927103A0C28 for ; Sun, 31 May 2020 12:16:01 -0700 (PDT) Received: from oxusgaltgw03.schlund.de ([10.72.72.49]) by mrelay.perfora.net (mreueus003 [74.208.5.2]) with ESMTPSA (Nemesis) id 0LZgcc-1jGMPh1MUO-00lVlW; Sun, 31 May 2020 21:15:57 +0200 Date: Sun, 31 May 2020 15:15:56 -0400 (EDT) From: Timothy Mcsweeney Reply-To: Timothy Mcsweeney To: Michael Wojcik , uri-review@ietf.org Message-ID: <1924775136.405242.1590952556836@email.ionos.com> In-Reply-To: References: <491516506.246380.1589851279474@email.ionos.com> <5EC9B257.31362.CC5E003@dan.tobias.name> <1783049000.100771.1590323508943@email.ionos.com> <5ECA8A94.23977.101292FE@dan.tobias.name> <1426881880.158099.1590335585858@email.ionos.com> <94368b41-c15b-da2c-421d-fdd9300be6e9@dret.net> <1310141163.159340.1590344745080@email.ionos.com> <1081815563.141711.1590624311343@email.ionos.com> <117630321.142251.1590627970509@email.ionos.com> <8ae1641a-74c8-6c2d-7092-6cf53e745fb7@ninebynine.org> <797476254.282655.1590770737009@email.ionos.com> <656ab4ec-df34-c7a4-ed36-79a03623636c@ninebynine.org> <1435838702.391137.1590841215132@email.ionos.com> MIME-Version: 1.0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: 7bit X-Priority: 3 Importance: Normal X-Mailer: Open-Xchange Mailer v7.10.1-Rev31 X-Originating-Client: open-xchange-appsuite X-Provags-ID: V03:K1:/3zOHh5wSg3cYyiLjEGLJmUm5G1zoU+c1s+0TnMfYxTuNIX8kxO 0UXhdQ473oa2Ejh/92t2Ao8PXZ/jevOeJBxQhw1INvNkFHGT39LQA59ANW8z6zMWydFVSTs HW5q/MwneBobvAiLO+BEzbZOcLlEh8bl2xg/5uZnskuWnJDO2IFeLD4W+XbmDQdVyxcHpQA 6OFGzLvrPf4bMQUuIQUoQ== X-UI-Out-Filterresults: notjunk:1;V03:K0:c1MIxM29d5U=:m3gY874pby0uz8zYsTmr2z rw4j+2+qdkH3FHAOwGhhW501RdxappzvinBChuhgzTGxggNRHJpWbdift5BzpA96YaTOyBzU8 auB7BdUPpElQ945IyrUzoa6RKJG8RN5PlCkyR7uVDroN+G/dtDtoGzXhhwe7+oZd5dJbfhGP9 D22S8nWhHnJApjObil3evwHOuD+bwJao0EYWVnVpaBYFuBVNvgKZ9Zu6RcY61zk+8q53n5rtL 8BYmo8uMzNjQWOuPNWqm1tX5RqpA1TigfQ9GOcGNoJD2yg8APMu6Us1PlUfayT0CPeOVVTveg CXrsv0JTL/Ivshs3vgaghdCrGbioz2aYIexCJPrpgHE1258UcjWzoRXa8G8+VAVBmiKnohKuw pYQR7pl/lwIcOIzuSgn8D4IBN3ld5cW+8wk62FiuEHE+n1PIHO3ue+uEFXa974OJDNFaXHLyV fBX08JMXuiUh2RAnpAnOgBTYEKx8whJd0e34IjhYeZhYktnXTlv87FqSUNq8aHGnyALNLpf2V 7GZDpXkO9z93rrG5KuCP3lPxovxIlQiTKxEz5ond5IPegjkBMDhG5PC8vgVT5WrckhDThxW3H 5tNs6tHjszhhpkgfMJsvH4v1Auiwi9607R/AgLOHcnu2NsFo30agB3qhQ9h9Jm/IXnn4R7cd2 VuYhRV4mOBXgkSqbyxeOsUIkfdzjk8UyjXhPncAvsVX+WazydDXyXjBukSNgAt2u6+wy5BGHu Ipyww5w+8ilTbTvT4kY1RT74aIryj2kurFEhMPySWZ11ef9F5IsBU/pSMOr0opJAxSldGVd96 MRI4iQwK1URjtEMkm/Wtfua0M1qhTw91Nny5/pRNgF6MGjNwUjj/8mbuO9Gpl3mTcv/m7BP Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 31 May 2020 19:16:06 -0000
>The issue here is that you're misinterpreting RFC 3986.

I noticed two of the original authors are on the email list.  It would
be nice to hear what the original interpretation was.

>To be honest, I don't understand why you're being so difficult about this.
 
Having a different perspective is no being difficult. 
Imagine the first color blind person telling everyone the grass is dark gray.




On May 30, 2020 at 10:01 AM Michael Wojcik < Michael.Wojcik@microfocus.com> wrote:


From: Uri-review [mailto: uri-review-bounces@ietf.org] On Behalf Of Timothy Mcsweeney
Sent: Saturday, May 30, 2020 06:20
To: Graham Klyne; uri-review@ietf.org
And if people want to make parsers that don't work with the spec it doesn't
become the spec's problem.
That's not the issue here. The issue here is that you're misinterpreting RFC 3986.

3986 section 3 is not ambiguous. The first production is:

URI = scheme ":" hier-part [ "?" query ] [ "#" fragment ]

The colon is explicit and not optional. A minimal URI consists of a scheme, a colon, and a hier-part. There's no wiggle room there, and no amount of casuistry regarding other parts of 3986 will change that.

Someone could also point to 1.2.3, where the language clearly notes that the colon is the scheme delimiter; or 3.5, which makes it clear that the hash symbol is always the fragment delimiter. But those arguments are redundant in light of the generic-URI top-level production that begins section 3.

To be honest, I don't understand why you're being so difficult about this. What's your motive for trying to find grounds in 3986 for repurposing the fragment identifier?

--
Michael Wojcik
From nobody Sun May 31 14:16:45 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 6DDB63A0DA7 for ; Sun, 31 May 2020 14:16:44 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.499 X-Spam-Level: X-Spam-Status: No, score=-1.499 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_EF=-0.1, FREEMAIL_FORGED_FROMDOMAIN=0.249, FREEMAIL_FROM=0.001, HEADER_FROM_DIFFERENT_DOMAINS=0.249, HTML_MESSAGE=0.001, SPF_HELO_NONE=0.001, SPF_PASS=-0.001, URIBL_BLOCKED=0.001] autolearn=no autolearn_force=no Authentication-Results: ietfa.amsl.com (amavisd-new); dkim=pass (2048-bit key) header.d=gmail.com Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id 3KS_-5rw1vT9 for ; Sun, 31 May 2020 14:16:42 -0700 (PDT) Received: from mail-pj1-x1041.google.com (mail-pj1-x1041.google.com [IPv6:2607:f8b0:4864:20::1041]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id A79F43A0DA5 for ; Sun, 31 May 2020 14:16:42 -0700 (PDT) Received: by mail-pj1-x1041.google.com with SMTP id k2so4114599pjs.2 for ; Sun, 31 May 2020 14:16:42 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=sender:from:to:cc:references:in-reply-to:subject:date:message-id :mime-version:thread-index:content-language; bh=imfYO6rm5ZWMiuBBMflmZ4mM5NVMv0YcQdX4D4mfPgM=; b=As1vBiHVYo3Y3vVI2eGUmJiy6XH7wADZWCATSe92XaRv102HEuYFxc99bY2V81JWEp m6KtZX2K07wDy02hMfZJe0UVs+kTmeXvdjt5rpXvPHtB8ALp6trJmsLw2oueCPmDOn+s WBGKfbIgcQHlPmNGRm9gGDsEV3pRhZxi83Az4bWeJK+/6vrYfG8BT+sNIG4q9PPWxk/8 Im7LCL4f37Byfns7y4YgNsJF/Ss/xNayA4fsx7EJLfAn2CGs4k7jteBmXGlrQIPgW5+f YE63B2dFQcz1XHgFVa6eA7sEda70Gu6SUX1b/0EWELOPYoFzcdPdk8xCJqhQUv8qHiYu ksqw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:sender:from:to:cc:references:in-reply-to:subject :date:message-id:mime-version:thread-index:content-language; bh=imfYO6rm5ZWMiuBBMflmZ4mM5NVMv0YcQdX4D4mfPgM=; b=rsVQIVhn3cRNGICw1T2+r+klY/h8UMVnQAVjFg+396TBlBfEPjuDcDXVrkGSosSpKX jYHB75WLtm2MpCD0y9FVcyTMatTVFYi1IWD1gE0epfvazCykJsRZaRaqCumUr1ls7LxU ENr6mUtjI++13Re3ic3E5Gk/l9/eX83BSrsdrDdCj7M6PTNceyM/aO2Xk1vk8Xzlzwx5 r+0QC354dDv23gPq71N0TEkKAfXi/0vHHUyyokNedSgGTjNA33EHJLmB92bY6mz7EH/y ey6lDXZNYnl3X5k1IF5YxxHOU4kv/xZqnCYDjCKmUsr1DvDUBxP41Eo3ZnbdfOArtX6s X+Cg== X-Gm-Message-State: AOAM533Tq9UaElXLM9GYz7hVkLavBE+8fYxDN7H0YDaHPL/JHem0K4a2 nwDSKRGFbgyUpk9Jmv5h6bw= X-Google-Smtp-Source: ABdhPJzd2l2htIrdsPphFSslb/8xTnImw3QsMIz3sUNKXE4v6PPU3twugmqhyizxC6G6HFsLYJGxTw== X-Received: by 2002:a17:902:c807:: with SMTP id u7mr4876684plx.16.1590959801920; Sun, 31 May 2020 14:16:41 -0700 (PDT) Received: from TVPC (c-67-169-101-78.hsd1.ca.comcast.net. [67.169.101.78]) by smtp.gmail.com with ESMTPSA id i26sm1641735pfo.0.2020.05.31.14.16.40 (version=TLS1_2 cipher=ECDHE-ECDSA-AES128-GCM-SHA256 bits=128/128); Sun, 31 May 2020 14:16:40 -0700 (PDT) Sender: Larry Masinter From: Larry Masinter X-Google-Original-From: "Larry Masinter" To: "'Timothy Mcsweeney'" , "'Michael Wojcik'" , Cc: "'Eliot Lear'" References: <491516506.246380.1589851279474@email.ionos.com> <5EC9B257.31362.CC5E003@dan.tobias.name> <1783049000.100771.1590323508943@email.ionos.com> <5ECA8A94.23977.101292FE@dan.tobias.name> <1426881880.158099.1590335585858@email.ionos.com> <94368b41-c15b-da2c-421d-fdd9300be6e9@dret.net> <1310141163.159340.1590344745080@email.ionos.com> <1081815563.141711.1590624311343@email.ionos.com> <117630321.142251.1590627970509@email.ionos.com> <8ae1641a-74c8-6c2d-7092-6cf53e745fb7@ninebynine.org> <797476254.282655.1590770737009@email.ionos.com> <656ab4ec-df34-c7a4-ed36-79a03623636c@ninebynine.org> <1435838702.391137.1590841215132@email.ionos.com> <1924775136.405242.159095255 6836@email.ionos.com> In-Reply-To: <1924775136.405242.1590952556836@email.ionos.com> Date: Sun, 31 May 2020 14:16:40 -0700 Message-ID: <009601d63790$c79a12f0$56ce38d0$@acm.org> MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="----=_NextPart_000_0097_01D63756.1B3C7370" X-Mailer: Microsoft Outlook 16.0 Thread-Index: AQGymr+RgmqR9KoorXl3tuJq/szTFwJYR2XSAqdVj/oCFtS2vgLcgkTOALiKKd8Dq5pEqAFDTkSgAZtVRbsB/PlolAHSMfbTAeyayrMDDafsLQHTAMmXAsRXq0oBYrpd8AFLHwJIAYT4f9Gn85X5MA== Content-Language: en-us Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 31 May 2020 21:16:44 -0000 This is a multipart message in MIME format. ------=_NextPart_000_0097_01D63756.1B3C7370 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable * I noticed two of the original authors are on the email list. It would = * be nice to hear what the original interpretation was.=20 =20 I wasn=E2=80=99t going to respond, but if you want my opinion, = it=E2=80=99s that=20 =20 we should change the registration form for new URI schemes to make this = more explicit, And we should consider updates to BCP 35/BCP 115 (Guidelines and = Registration Procedures for URI schemes to figure out a way to terminate = this kind of discussion. =20 I note that this re-(mis-)use of fragment identifier isn=E2=80=99t so = different from the URN wish to repurpose =E2=80=9C#=E2=80=9D. That we never required media type registrations to explain their = interpretation of fragment identifiers. We should. I note that for HTTP we can say =E2=80=9Cthe fragment identifier = isn=E2=80=99t sent to the server, only the base full URL=E2=80=9D but = that is not actually required and isn=E2=80=99t true for = =E2=80=9Cfile=E2=80=9D URLs since in that case there is no particular = =E2=80=9Cserver=E2=80=9D. I point out = https://developer.mozilla.org/en-US/docs/Web/API/Navigator/registerProtoc= olHandler=20 The = Navigator method registerProtocolHandler() lets web sites register their = ability to open or handle particular URL schemes (aka protocols).=20 For example, this API lets webmail sites open mailto: URLs, or VoIP = sites open tel: URLs. Which allows you to define =E2=80=9Cdrop=E2=80=9D URLs (which of course = start with =E2=80=9Cdrop:=E2=80=9D) =20 =20 From: Uri-review On Behalf Of Timothy = Mcsweeney Sent: Sunday, May 31, 2020 12:16 PM To: Michael Wojcik ; uri-review@ietf.org Subject: Re: [Uri-review] Request for review =20 >The issue here is that you're misinterpreting RFC 3986.=20 =20 I noticed two of the original authors are on the email list. It would=20 be nice to hear what the original interpretation was.=20 =20 >To be honest, I don't understand why you're being so difficult about = this.=20 =20 Having a different perspective is no being difficult. =20 Imagine the first color blind person telling everyone the grass is dark = gray.=20 =20 =20 =20 =20 On May 30, 2020 at 10:01 AM Michael Wojcik < = Michael.Wojcik@microfocus.com > = wrote:=20 =20 =20 From: Uri-review [mailto: uri-review-bounces@ietf.org = ] On Behalf Of Timothy Mcsweeney=20 Sent: Saturday, May 30, 2020 06:20=20 To: Graham Klyne; uri-review@ietf.org =20 And if people want to make parsers that don't work with the spec it = doesn't=20 become the spec's problem.=20 That's not the issue here. The issue here is that you're misinterpreting = RFC 3986.=20 =20 3986 section 3 is not ambiguous. The first production is:=20 =20 URI =3D scheme ":" hier-part [ "?" query ] [ "#" fragment ]=20 =20 The colon is explicit and not optional. A minimal URI consists of a = scheme, a colon, and a hier-part. There's no wiggle room there, and no = amount of casuistry regarding other parts of 3986 will change that.=20 =20 Someone could also point to 1.2.3, where the language clearly notes that = the colon is the scheme delimiter; or 3.5, which makes it clear that the = hash symbol is always the fragment delimiter. But those arguments are = redundant in light of the generic-URI top-level production that begins = section 3.=20 =20 To be honest, I don't understand why you're being so difficult about = this. What's your motive for trying to find grounds in 3986 for = repurposing the fragment identifier?=20 =20 --=20 Michael Wojcik=20 ------=_NextPart_000_0097_01D63756.1B3C7370 Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: quoted-printable
  • I noticed two of the = original authors are on the email list.  It would =
  • be nice to hear what = the original interpretation was.

 

I = wasn=E2=80=99t going to respond, but if you want my opinion, = it=E2=80=99s that

 

we should = change the registration form for new URI schemes to make this more = explicit,

And we should consider = updates to BCP 35/BCP 115 (Guidelines and Registration Procedures for = URI schemes to figure out a way to terminate this kind of = discussion.

 

I note that this re-(mis-)use of fragment identifier = isn=E2=80=99t so different from the URN wish to repurpose = =E2=80=9C#=E2=80=9D.

That we never = required media type registrations to explain their interpretation of = fragment identifiers. We should.

I = note that for HTTP we can say =E2=80=9Cthe fragment identifier = isn=E2=80=99t sent to the server, only the base full URL=E2=80=9D but = that is not actually required and isn=E2=80=99t true for = =E2=80=9Cfile=E2=80=9D URLs since in that case there is no particular = =E2=80=9Cserver=E2=80=9D.

I point = out https://developer.mozilla.org/en-US/docs/Web/API/Navig= ator/registerProtocolHandler =

=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0The Navigator method registerProtocolHandler() = lets web sites register their ability to open or handle particular URL = schemes (aka protocols). =

=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0For example, this API = lets webmail sites open mailto: URLs, or VoIP sites = open tel: = URLs.

Which allows you to define = =E2=80=9Cdrop=E2=80=9D URLs (which of course start with = =E2=80=9Cdrop:=E2=80=9D)

 

 

From: = Uri-review <uri-review-bounces@ietf.org> On Behalf Of = Timothy Mcsweeney
Sent: Sunday, May 31, 2020 12:16 = PM
To: Michael Wojcik <Michael.Wojcik@microfocus.com>; = uri-review@ietf.org
Subject: Re: [Uri-review] Request for = review

 

>The = issue here is that you're misinterpreting RFC 3986. =

 

I = noticed two of the original authors are on the email list.  It = would

be nice to hear = what the original interpretation was.

 

>To be honest, I don't understand why you're being = so difficult about this.

 

Having a different perspective is no being = difficult. 

Imagine = the first color blind person telling everyone the grass is dark gray. =

 

 

 

 

On May 30, 2020 at 10:01 AM Michael Wojcik < Michael.Wojcik@microfocus.c= om> wrote:

 

 

And if people want to make parsers that don't work = with the spec it doesn't

become the spec's problem. =

That's not = the issue here. The issue here is that you're misinterpreting RFC 3986. =

 

3986 section 3 is not ambiguous. The first production = is:

 

URI =3D scheme ":" hier-part [ "?" = query ] [ "#" fragment ]

 

The colon is explicit and not optional. A minimal URI = consists of a scheme, a colon, and a hier-part. There's no wiggle room = there, and no amount of casuistry regarding other parts of 3986 will = change that.

 

Someone could also point to 1.2.3, where the language = clearly notes that the colon is the scheme delimiter; or 3.5, which = makes it clear that the hash symbol is always the fragment delimiter. = But those arguments are redundant in light of the generic-URI top-level = production that begins section 3.

 

To be honest, I don't understand why you're being so = difficult about this. What's your motive for trying to find grounds in = 3986 for repurposing the fragment identifier? =

 

--

Michael Wojcik =

------=_NextPart_000_0097_01D63756.1B3C7370-- From nobody Sun May 31 14:54:09 2020 Return-Path: X-Original-To: uri-review@ietfa.amsl.com Delivered-To: uri-review@ietfa.amsl.com Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 4DAE53A0DFB; Sun, 31 May 2020 14:54:07 -0700 (PDT) X-Virus-Scanned: amavisd-new at amsl.com X-Spam-Flag: NO X-Spam-Score: -1.795 X-Spam-Level: X-Spam-Status: No, score=-1.795 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, HTML_MESSAGE=0.001, MIME_HTML_ONLY=0.1, RCVD_IN_MSPIKE_H3=0.001, RCVD_IN_MSPIKE_WL=0.001, SPF_NONE=0.001, URIBL_BLOCKED=0.001] autolearn=no autolearn_force=no Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id XBMIuIeP5MCq; Sun, 31 May 2020 14:54:05 -0700 (PDT) Received: from mout.perfora.net (mout.perfora.net [74.208.4.194]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id BA0033A0DFA; Sun, 31 May 2020 14:54:05 -0700 (PDT) Received: from oxusgaltgw02.schlund.de ([10.72.72.48]) by mrelay.perfora.net (mreueus004 [74.208.5.2]) with ESMTPSA (Nemesis) id 1MiaDb-1j1mxz1MU3-00fi0q; Sun, 31 May 2020 23:54:00 +0200 Date: Sun, 31 May 2020 17:53:58 -0400 (EDT) From: Timothy Mcsweeney Reply-To: Timothy Mcsweeney To: Larry Masinter , Michael Wojcik , uri-review@ietf.org Cc: Eliot Lear Message-ID: <1225920323.477357.1590962038349@email.ionos.com> In-Reply-To: <009601d63790$c79a12f0$56ce38d0$@acm.org> References: <491516506.246380.1589851279474@email.ionos.com> <5EC9B257.31362.CC5E003@dan.tobias.name> <1783049000.100771.1590323508943@email.ionos.com> <5ECA8A94.23977.101292FE@dan.tobias.name> <1426881880.158099.1590335585858@email.ionos.com> <94368b41-c15b-da2c-421d-fdd9300be6e9@dret.net> <1310141163.159340.1590344745080@email.ionos.com> <1081815563.141711.1590624311343@email.ionos.com> <117630321.142251.1590627970509@email.ionos.com> <8ae1641a-74c8-6c2d-7092-6cf53e745fb7@ninebynine.org> <797476254.282655.1590770737009@email.ionos.com> <656ab4ec-df34-c7a4-ed36-79a03623636c@ninebynine.org> <1435838702.391137.1590841215132@email.ionos.com> <1924775136.405242.159095255 6836@email.ionos.com> <009601d63790$c79a12f0$56ce38d0$@acm.org> MIME-Version: 1.0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-Priority: 3 Importance: Normal X-Mailer: Open-Xchange Mailer v7.10.1-Rev31 X-Originating-Client: open-xchange-appsuite X-Provags-ID: V03:K1:olsODbCklg5qAMXCzKKKZ5XbhdlYN1TiaN7hMsPQLaToH9gvbDZ pJORJ84wWNdBdd7Tbdrr3mmDVsXqVzxzCa/rBPbOgSpou4KGaj5KFQdW6yiNHs5sr5y8BXa BTcgVuY4wUf0boVJDpTItcvpBBBfHIC2y5SPEp+MpfN7p7ZMlmn7yJVti1y481csnn+A5Qn dmD6mM49RhZy2R6CYLysw== X-UI-Out-Filterresults: notjunk:1;V03:K0:xRn4utdtiEU=:jVIoXpjLorchMwCgNEPw37 B/6Nzs7kR5tGSm4guofIpk5bhRTYbNGjAs7SmF9zwiLxj8or0W404YDUDNHstPFxehWx7KaB0 SqN2dzwYEtoskpzklycm37reHvhk4A0QE0XmhA/0rbUMmC4lNmt9pjnAY3ezQ78b9LGcLaU41 qX6FXJd+c3P+9ByOymwlcjIonBLd9ziuGatqSOPgmaA0chvwuo2Z2VDGmpuZoOSmY4X98izzr 3d0gizhO0sGSfNT1JfvTTNatGB7IF4UmUWugpHVCU1g7LzfuxDB9VHfejubimI6yVX0olh3tT QNaFJIFAuAjw77CIG5UQtRDrxIGq5S602P/5Uk22pPvUOcyHqjTZXEJGZxjdOZQHKv1LdKeyb NXpd8W6RY26sCQGf3SEpWErEe8G1zMjGEE0yf4XRY6DR+WHmzXWjUW6og+1K8NyP666nBYCPR WxKnYOWpQbdRbJDRWuwgMnCF0GD3+0y6j96BmnPmfuxZlbGjzsMHTcl8VHYu9J+2qZbAgL3CR WdzLj2biOhkJBl/DxBQM/HZV7+/4y5FNECb8886tzzIlsOMJ92IONRRUYoRhPg6gtMD7BaLFD e/a4l+EA+qdY7lm/TwwjDXrxAheKYI58dpZHWVBX67PEXxMzpZdQQWKpP9TAXvJqOJzcnbk7D XCFx3WeYYUkjHYaK7uMLNI5zNhTcmHfZzGcENmf4ZQxJa9Rv0m00egwtQGw/wr01N7s6ibNzK Et086Tj7D85mV0k31D01WeNYStRE/SEdnM3NFljI3rNdBfiWglqEcUZFozwtza32AzzOdWuwI cJlhBSLWrxBbDtPwvScmlAT+9fWD8uweGlIaxBKpNC78qhYln66jCxxqdOOHiolExeZzUUz Archived-At: Subject: Re: [Uri-review] Request for review X-BeenThere: uri-review@ietf.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Proposed URI Schemes List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 31 May 2020 21:54:07 -0000 =20 =20
Hi Larry, 

Just so its crystal clear in my head, you're saying that the original in= tent of 3986
was that the colon, and only the colon, was to be used as the gen-delim = between
scheme and path regardless of implementation specific sytanx?  I ha= ve that right?
On May 31, 2020 at 5:16 PM Larry Masinter <LMM@acm.org> wrote:=20

  • I noticed two of the original authors are on the email list.  It wo= uld
  • be nice to hear what the original interpretation was.


I wasn=E2=80=99t going to respond,= but if you want my opinion, it=E2=80=99s that


we should change the registration = form for new URI schemes to make this more explicit,

And we should consider updates to = BCP 35/BCP 115 (Guidelines and Registration Procedures for URI schemes to f= igure out a way to terminate this kind of discussion.


I note that this re-(mis-)use of f= ragment identifier isn=E2=80=99t so different from the URN wish to repurpos= e =E2=80=9C#=E2=80=9D.

That we never required media type = registrations to explain their interpretation of fragment identifiers. We s= hould.

I note that for HTTP we can say = =E2=80=9Cthe fragment identifier isn=E2=80=99t sent to the server, only the= base full URL=E2=80=9D but that is not actually required and isn=E2=80=99t= true for =E2=80=9Cfile=E2=80=9D URLs since in that case there is no partic= ular =E2=80=9Cserver=E2=80=9D.

I point out ht= tps://developer.mozilla.org/en-US/docs/Web/API/Navigator/registerProtocolHa= ndler

      The = Navigator= method registerProtoc= olHandler() lets w= eb sites register their ability to open or handle particular URL schemes (a= ka protocols).

     For example, this API lets webmail sit= es open mailto: URLs= , or VoIP sites open tel: URLs.

Which allows you to define =E2=80= =9Cdrop=E2=80=9D URLs (which of course start with =E2=80=9Cdrop:=E2=80=9D)<= /p>



From: Uri-revi= ew <uri-review-bounces@ietf.org> On Behalf Of Timoth= y Mcsweeney
Sent: Sunday, May 31, 2020 12:16 PM
To: Michael Wojcik <Michael.Wojcik@microfocus.com>; uri-= review@ietf.org
Subject: Re: [Uri-review] Request for r= eview


>The issue here is that you'r= e misinterpreting RFC 3986.


I noticed two of the original au= thors are on the email list.  It would

be nice to hear what the origina= l interpretation was.


>To be honest, I don't unders= tand why you're being so difficult about this.


Having a different perspective i= s no being difficult. 

Imagine the first color blind pe= rson telling everyone the grass is dark gray.





On May 30, 2020 at 10:01 AM Mic= hael Wojcik < Michael.W= ojcik@microfocus.com> wrote:



From: Uri-review [mailto: uri-review-bounces@ietf.org]= On Behalf Of Timothy Mcsweeney

Sent: Saturday, May 30, 2020 0= 6:20

To: Graham Klyne; uri-review@ietf.org

And if people want to make par= sers that don't work with the spec it doesn't

become the spec's problem.

That's not the issue here. The = issue here is that you're misinterpreting RFC 3986.


3986 section 3 is not ambiguous= . The first production is:


URI =3D scheme ":" hier-part [ = "?" query ] [ "#" fragment ]


The colon is explicit and not o= ptional. A minimal URI consists of a scheme, a colon, and a hier-part. Ther= e's no wiggle room there, and no amount of casuistry regarding other parts = of 3986 will change that.


Someone could also point to 1.2= .3, where the language clearly notes that the colon is the scheme delimiter= ; or 3.5, which makes it clear that the hash symbol is always the fragment = delimiter. But those arguments are redundant in light of the generic-URI to= p-level production that begins section 3.


To be honest, I don't understan= d why you're being so difficult about this. What's your motive for trying t= o find grounds in 3986 for repurposing the fragment identifier?


--

Michael Wojcik


 
=20